Gene Gene information from NCBI Gene database.
Entrez ID 353322
Gene name Ankyrin repeat domain 37
Gene symbol ANKRD37
Synonyms (NCBI Gene)
Lrp2bp
Chromosome 4
Chromosome location 4q35.1
miRNA miRNA information provided by mirtarbase database.
8
miRTarBase ID miRNA Experiments Reference
MIRT783728 hsa-miR-330-3p CLIP-seq
MIRT783729 hsa-miR-4422 CLIP-seq
MIRT783730 hsa-miR-4731-3p CLIP-seq
MIRT783731 hsa-miR-4801 CLIP-seq
MIRT2171789 hsa-miR-1273d CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
8
GO ID Ontology Definition Evidence Reference
GO:0001673 Component Male germ cell nucleus IEA
GO:0005515 Function Protein binding IPI 32296183
GO:0005634 Component Nucleus IEA
GO:0005654 Component Nucleoplasm IDA
GO:0005737 Component Cytoplasm IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
619021 29593 ENSG00000186352
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q7Z713
Protein name Ankyrin repeat domain-containing protein 37 (Low-density lipoprotein receptor-related protein 2-binding protein) (hLrp2bp)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13637 Ank_4 64 117 Repeat
Tissue specificity TISSUE SPECIFICITY: Mainly expressed in testis, small intestine, colon, blood leukocytes and in pancreatic adenocarcinoma cells. {ECO:0000269|PubMed:15809689}.
Sequence
MLLLDCNPEVDGLKHLLETGASVNAPPDPCKQSPVHLAAGSGLACFLLWQLQTGADLNQQ
DVLGEAPLHKAAKVGSLECLSLLVASDAQIDLCNKNGQTAEDLAWSCGFPDCAKFLTTIK
CMQTIKASEHPDRNDCVAVLRQKRSLGSVENTSGKRKC
Sequence length 158
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
CONGENITAL DYSPLASIA OF THE HIP Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
SYSTEMIC SCLERODERMA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Anemia Iron Deficiency Iron deficiency anemia Pubtator 29110513 Associate
★☆☆☆☆
Found in Text Mining only
Arteriosclerosis Arteriosclerosis BEFREE 29363163
★☆☆☆☆
Found in Text Mining only
Asthma Asthma GWASDB_DG 20698975
★☆☆☆☆
Found in Text Mining only
Atherosclerosis Atherosclerosis BEFREE 29363163
★☆☆☆☆
Found in Text Mining only
Autism Spectrum Disorder Autism Pubtator 29523860 Associate
★☆☆☆☆
Found in Text Mining only
Autism Spectrum Disorders Autism Spectrum Disorder BEFREE 29523860
★☆☆☆☆
Found in Text Mining only
Behavior Disorders Behavior Disorders BEFREE 28850114
★☆☆☆☆
Found in Text Mining only
Clear-cell metastatic renal cell carcinoma Renal Carcinoma BEFREE 25715653
★☆☆☆☆
Found in Text Mining only
Intellectual Disability Mental retardation BEFREE 28850114
★☆☆☆☆
Found in Text Mining only
Intellectual Disability Intellectual developmental disorder Pubtator 28850114 Associate
★☆☆☆☆
Found in Text Mining only