ANKRD37 (ankyrin repeat domain 37)

Gene

• Entrez ID: 353322
• Gene name: Ankyrin repeat domain 37
• Gene symbol: ANKRD37
• Synonyms (NCBI Gene): Lrp2bp
• Chromosome: 4
• Chromosome location: 4q35.1

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT783728	hsa-miR-330-3p	CLIP-seq
MIRT783729	hsa-miR-4422	CLIP-seq
MIRT783730	hsa-miR-4731-3p	CLIP-seq
MIRT783731	hsa-miR-4801	CLIP-seq
MIRT2171789	hsa-miR-1273d	CLIP-seq
MIRT2171790	hsa-miR-4494	CLIP-seq
MIRT2171791	hsa-miR-4778-3p	CLIP-seq
MIRT2171792	hsa-miR-499a-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001673	Component	Male germ cell nucleus	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IDA
GO:0005829	Component	Cytosol	IDA

Other IDs

• MIM: 619021
• HGNC: 29593
• e!Ensembl: ENSG00000186352

Protein

• UniProt ID: Q7Z713
• Protein name: Ankyrin repeat domain-containing protein 37 (Low-density lipoprotein receptor-related protein 2-binding protein) (hLrp2bp)
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13637	Ank_4	64 → 117		Repeat

• Tissue specificity: TISSUE SPECIFICITY: Mainly expressed in testis, small intestine, colon, blood leukocytes and in pancreatic adenocarcinoma cells. {ECO:0000269|PubMed:15809689}.
• Sequence:

  MLLLDCNPEVDGLKHLLETGASVNAPPDPCKQSPVHLAAGSGLACFLLWQLQTGADLNQQ
  DVLGEAPLHKAAKVGSLECLSLLVASDAQIDLCNKNGQTAEDLAWSCGFPDCAKFLTTIK
  CMQTIKASEHPDRNDCVAVLRQKRSLGSVENTSGKRKC

• Sequence length: 158

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CONGENITAL DYSPLASIA OF THE HIP	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC SCLERODERMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Anemia Iron Deficiency	Iron deficiency anemia	Pubtator	29110513	Associate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	29363163		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	GWASDB_DG	20698975		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	29363163		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	29523860	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	29523860		★☆☆☆☆ Found in Text Mining only
Behavior Disorders	Behavior Disorders	BEFREE	28850114		★☆☆☆☆ Found in Text Mining only
Clear-cell metastatic renal cell carcinoma	Renal Carcinoma	BEFREE	25715653		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	28850114		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	28850114	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Facioscapulohumeral	Facioscapulohumeral muscular dystrophy	Pubtator	19809486, 19888305	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Facioscapulohumeral	Facioscapulohumeral Muscular Dystrophy	BEFREE	17151338		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	28850114		★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	33069728	Associate	★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	33069728	Associate	★☆☆☆☆ Found in Text Mining only