LCE1C (late cornified envelope 1C)

Gene

• Entrez ID: 353133
• Gene name: Late cornified envelope 1C
• Gene symbol: LCE1C
• Synonyms (NCBI Gene): LEP3
• Chromosome: 1
• Chromosome location: 1q21.3

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT2029094	hsa-miR-1299	CLIP-seq
MIRT2029095	hsa-miR-378	CLIP-seq
MIRT2029096	hsa-miR-378b	CLIP-seq
MIRT2029097	hsa-miR-378c	CLIP-seq
MIRT2029098	hsa-miR-378d	CLIP-seq
MIRT2029099	hsa-miR-378e	CLIP-seq
MIRT2029100	hsa-miR-378f	CLIP-seq
MIRT2029101	hsa-miR-378h	CLIP-seq
MIRT2029102	hsa-miR-378i	CLIP-seq
MIRT2029103	hsa-miR-422a	CLIP-seq
MIRT2029104	hsa-miR-4638-3p	CLIP-seq
MIRT2029105	hsa-miR-4668-5p	CLIP-seq
MIRT2029106	hsa-miR-4685-5p	CLIP-seq
MIRT2029107	hsa-miR-4782-5p	CLIP-seq
MIRT2029108	hsa-miR-508-5p	CLIP-seq
MIRT2029109	hsa-miR-516b	CLIP-seq
MIRT2029094	hsa-miR-1299	CLIP-seq
MIRT2029095	hsa-miR-378	CLIP-seq
MIRT2029096	hsa-miR-378b	CLIP-seq
MIRT2029097	hsa-miR-378c	CLIP-seq
MIRT2029098	hsa-miR-378d	CLIP-seq
MIRT2029099	hsa-miR-378e	CLIP-seq
MIRT2029100	hsa-miR-378f	CLIP-seq
MIRT2029101	hsa-miR-378h	CLIP-seq
MIRT2029102	hsa-miR-378i	CLIP-seq
MIRT2029103	hsa-miR-422a	CLIP-seq
MIRT2029104	hsa-miR-4638-3p	CLIP-seq
MIRT2029105	hsa-miR-4668-5p	CLIP-seq
MIRT2029106	hsa-miR-4685-5p	CLIP-seq
MIRT2029107	hsa-miR-4782-5p	CLIP-seq
MIRT2029108	hsa-miR-508-5p	CLIP-seq
MIRT2029109	hsa-miR-516b	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0008544	Process	Epidermis development	IEA
GO:0031424	Process	Keratinization	IEA

Other IDs

• MIM: 612605
• HGNC: 29464
• e!Ensembl: ENSG00000197084

Protein

• UniProt ID: Q5T751
• Protein name: Late cornified envelope protein 1C (Late envelope protein 3)
• Protein function: Precursors of the cornified envelope of the stratum corneum.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF14672	LCE	27 → 61	Late cornified envelope	Family
  PF14672	LCE	57 → 118	Late cornified envelope	Family

• Tissue specificity: TISSUE SPECIFICITY: Skin-specific. Expression was readily detected in adult trunk skin, adult arm skin, fetal skin, penal skin, vulva, esophagus and tongue. Not expressed in the cervix, rectum, lung, colon, or placenta. {ECO:0000269|PubMed:15854049}.
• Sequence:

  MSCQQSQQQCQPPPKCTPKCPPKCPTPKCPPKCPPKCPPVSSCCSVSSGGCCGSSSGGSC
  GSSSGGCCSSGGGGCCLSHHRRRRSHCHRPQSSGCCSQPSGGSSCCGGGSGQHSGGCC

• Sequence length: 118

Pathways

Reactome:

Formation of the cornified envelope

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ECZEMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHILDHOOD ONSET ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	18369459	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	18369459	Associate	★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	18369459	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	18369459	Associate	★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	18369459	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	16762576		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	16762576, 18725053, 29893028		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	18369459, 20643763	Associate	★☆☆☆☆ Found in Text Mining only