APP (amyloid beta precursor protein)

Gene

• Entrez ID: 351
• Gene name: Amyloid beta precursor protein
• Gene symbol: APP
• Synonyms (NCBI Gene): AAA, ABETA, ABPP, AD1, APPI, CTFgamma, CVAP, PN-II, PN2, alpha-sAPP, preA4
• Chromosome: 21
• Chromosome location: 21q21.3
• Summary: This gene encodes a cell surface receptor and transmembrane precursor protein that is cleaved by secretases to form a number of peptides. Some of these peptides are secreted and can bind to the acetyltransferase complex APBB1/TIP60 to promote transcriptio

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs63749810	C>T	Pathogenic, not-provided	Genic downstream transcript variant, coding sequence variant, missense variant
rs63749964	A>C	Pathogenic, not-provided	Genic downstream transcript variant, coding sequence variant, missense variant
rs63750064	C>G,T	Not-provided, likely-pathogenic	Genic downstream transcript variant, coding sequence variant, missense variant
rs63750066	C>T	Pathogenic, uncertain-significance, likely-pathogenic	Genic downstream transcript variant, coding sequence variant, missense variant
rs63750264	C>A,G,T	Pathogenic, not-provided	Genic downstream transcript variant, coding sequence variant, missense variant
rs63750363	C>G	Pathogenic, uncertain-significance	Genic downstream transcript variant, coding sequence variant, missense variant
rs63750399	T>A,C	Pathogenic, not-provided	Genic downstream transcript variant, coding sequence variant, missense variant
rs63750579	C>G,T	Pathogenic, not-provided	Genic downstream transcript variant, coding sequence variant, missense variant
rs63750643	T>C	Pathogenic, not-provided	Genic downstream transcript variant, coding sequence variant, missense variant
rs63750671	G>C	Pathogenic, not-provided	Genic downstream transcript variant, coding sequence variant, missense variant
rs63750734	C>T	Pathogenic, likely-pathogenic	Genic downstream transcript variant, coding sequence variant, missense variant
rs63750921	G>C	Pathogenic, not-provided	Genic downstream transcript variant, coding sequence variant, missense variant
rs63750973	G>A	Pathogenic, not-provided	Genic downstream transcript variant, coding sequence variant, missense variant
rs63751039	T>C	Pathogenic, not-provided	Genic downstream transcript variant, coding sequence variant, missense variant
rs145081708	A>G	Uncertain-significance, benign, conflicting-interpretations-of-pathogenicity	Missense variant, coding sequence variant
rs193922916	G>A,C	Pathogenic	Genic downstream transcript variant, missense variant, coding sequence variant
rs201269325	C>A,T	Likely-pathogenic	Genic downstream transcript variant, missense variant, coding sequence variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT001935	hsa-miR-106a-5p	Luciferase reporter assay	18684319
MIRT001935	hsa-miR-106a-5p	Western blot	18684319
MIRT001934	hsa-miR-520c-3p	Luciferase reporter assay	18684319
MIRT001934	hsa-miR-520c-3p	Western blot	18684319
MIRT001935	hsa-miR-106a-5p	qRT-PCR	18684319
MIRT001934	hsa-miR-520c-3p	qRT-PCR	18684319
MIRT001935	hsa-miR-106a-5p	Luciferase reporter assay, Western blot	18684319
MIRT001935	hsa-miR-106a-5p	Luciferase reporter assay, Western blot	18684319
MIRT001935	hsa-miR-106a-5p	Luciferase reporter assay, Western blot	18684319
MIRT001935	hsa-miR-106a-5p	Luciferase reporter assay, Western blot	18684319
MIRT001934	hsa-miR-520c-3p	Luciferase reporter assay, Western blot	18684319
MIRT001934	hsa-miR-520c-3p	Luciferase reporter assay, Western blot	18684319
MIRT001934	hsa-miR-520c-3p	Luciferase reporter assay, Western blot	18684319
MIRT001934	hsa-miR-520c-3p	Luciferase reporter assay, Western blot	18684319
MIRT000430	hsa-miR-101-3p	qRT-PCR, Luciferase reporter assay, Western blot	20395292
MIRT000430	hsa-miR-101-3p	qRT-PCR, Luciferase reporter assay, Western blot	20395292
MIRT003382	hsa-miR-20a-5p	GFP reporter assay, qRT-PCR, Western blot	20458444
MIRT003382	hsa-miR-20a-5p	GFP reporter assay, qRT-PCR, Western blot	20458444
MIRT003382	hsa-miR-20a-5p	GFP reporter assay, qRT-PCR, Western blot	20458444
MIRT003382	hsa-miR-20a-5p	Luciferase reporter assay, Western blot	19110058
MIRT003898	hsa-miR-17-5p	Luciferase reporter assay, Western blot	19110058
MIRT000373	hsa-miR-106b-5p	Luciferase reporter assay, Western blot	19110058
MIRT003899	hsa-miR-15a-5p	Luciferase reporter assay	19110058
MIRT003900	hsa-miR-130a-3p	Luciferase reporter assay	19110058
MIRT003901	hsa-let-7d-5p	Luciferase reporter assay	19110058
MIRT003902	hsa-let-7a-5p	Luciferase reporter assay	19110058
MIRT001935	hsa-miR-106a-5p	Luciferase reporter assay	19110058
MIRT000430	hsa-miR-101-3p	Luciferase reporter assay, qRT-PCR, Western blot	21172309
MIRT000430	hsa-miR-101-3p	Luciferase reporter assay, qRT-PCR, Western blot	21172309
MIRT000430	hsa-miR-101-3p	Luciferase reporter assay, qRT-PCR, Western blot	21172309
MIRT000430	hsa-miR-101-3p	Luciferase reporter assay, qRT-PCR, Western blot	21172309
MIRT031838	hsa-miR-16-5p	Proteomics	18668040
MIRT003898	hsa-miR-17-5p	CLASH	23622248
MIRT003898	hsa-miR-17-5p	CLASH	23622248
MIRT048186	hsa-miR-196a-5p	CLASH	23622248
MIRT046755	hsa-miR-222-3p	CLASH	23622248
MIRT046755	hsa-miR-222-3p	CLASH	23622248
MIRT043760	hsa-miR-328-3p	CLASH	23622248
MIRT042631	hsa-miR-423-3p	CLASH	23622248
MIRT042260	hsa-miR-484	CLASH	23622248
MIRT038001	hsa-miR-500a-5p	CLASH	23622248
MIRT037918	hsa-miR-532-3p	CLASH	23622248
MIRT052777	hsa-miR-1260b	CLASH	23622248
MIRT052777	hsa-miR-1260b	CLASH	23622248
MIRT052863	hsa-miR-3620-3p	CLASH	23622248
MIRT723035	hsa-miR-548ad-3p	HITS-CLIP	19536157
MIRT723034	hsa-miR-424-3p	HITS-CLIP	19536157
MIRT723033	hsa-miR-4484	HITS-CLIP	19536157
MIRT723032	hsa-miR-551b-5p	HITS-CLIP	19536157
MIRT723031	hsa-miR-3120-3p	HITS-CLIP	19536157
MIRT407081	hsa-miR-6504-3p	HITS-CLIP	19536157
MIRT710394	hsa-miR-3646	HITS-CLIP	19536157
MIRT710393	hsa-miR-6502-3p	HITS-CLIP	19536157
MIRT710392	hsa-miR-5584-5p	HITS-CLIP	19536157
MIRT549358	hsa-miR-4786-5p	HITS-CLIP	19536157
MIRT710391	hsa-miR-5093	HITS-CLIP	19536157
MIRT710389	hsa-miR-4709-3p	HITS-CLIP	19536157
MIRT705588	hsa-miR-224-3p	HITS-CLIP	23313552
MIRT705587	hsa-miR-522-3p	HITS-CLIP	23313552
MIRT705586	hsa-miR-3908	HITS-CLIP	23313552
MIRT705585	hsa-miR-197-5p	HITS-CLIP	23313552
MIRT705584	hsa-miR-3132	HITS-CLIP	23313552
MIRT705583	hsa-miR-6073	HITS-CLIP	23313552
MIRT705582	hsa-miR-3606-5p	HITS-CLIP	23313552
MIRT705581	hsa-miR-1229-5p	HITS-CLIP	23313552
MIRT660592	hsa-miR-548a-3p	HITS-CLIP	23824327
MIRT660591	hsa-miR-548ar-3p	HITS-CLIP	23824327
MIRT660590	hsa-miR-548az-3p	HITS-CLIP	23824327
MIRT660589	hsa-miR-548e-3p	HITS-CLIP	23824327
MIRT660588	hsa-miR-548f-3p	HITS-CLIP	23824327
MIRT660587	hsa-miR-5582-3p	HITS-CLIP	23824327
MIRT660586	hsa-miR-302b-5p	HITS-CLIP	23824327
MIRT660585	hsa-miR-302d-5p	HITS-CLIP	23824327
MIRT660584	hsa-miR-5696	HITS-CLIP	23824327
MIRT660583	hsa-miR-579-3p	HITS-CLIP	23824327
MIRT660582	hsa-miR-664b-3p	HITS-CLIP	23824327
MIRT660580	hsa-miR-7111-3p	HITS-CLIP	23824327
MIRT660581	hsa-miR-6780a-3p	HITS-CLIP	23824327
MIRT660579	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT660578	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT660577	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT660592	hsa-miR-548a-3p	HITS-CLIP	23824327
MIRT660591	hsa-miR-548ar-3p	HITS-CLIP	23824327
MIRT660590	hsa-miR-548az-3p	HITS-CLIP	23824327
MIRT660589	hsa-miR-548e-3p	HITS-CLIP	23824327
MIRT660588	hsa-miR-548f-3p	HITS-CLIP	23824327
MIRT660587	hsa-miR-5582-3p	HITS-CLIP	23824327
MIRT660586	hsa-miR-302b-5p	HITS-CLIP	23824327
MIRT660585	hsa-miR-302d-5p	HITS-CLIP	23824327
MIRT660584	hsa-miR-5696	HITS-CLIP	23824327
MIRT660583	hsa-miR-579-3p	HITS-CLIP	23824327
MIRT660582	hsa-miR-664b-3p	HITS-CLIP	23824327
MIRT660580	hsa-miR-7111-3p	HITS-CLIP	23824327
MIRT660581	hsa-miR-6780a-3p	HITS-CLIP	23824327
MIRT660579	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT660578	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT660577	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT559575	hsa-miR-944	PAR-CLIP	21572407
MIRT559573	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT559574	hsa-miR-567	PAR-CLIP	21572407
MIRT559572	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT559571	hsa-miR-3924	PAR-CLIP	21572407
MIRT559570	hsa-miR-297	PAR-CLIP	21572407
MIRT549363	hsa-miR-4311	PAR-CLIP	21572407
MIRT549362	hsa-miR-1276	PAR-CLIP	21572407
MIRT549361	hsa-miR-583	PAR-CLIP	21572407
MIRT549360	hsa-miR-4495	PAR-CLIP	21572407
MIRT549359	hsa-miR-4698	PAR-CLIP	21572407
MIRT549358	hsa-miR-4786-5p	PAR-CLIP	21572407
MIRT543081	hsa-miR-144-3p	PAR-CLIP	21572407
MIRT000430	hsa-miR-101-3p	PAR-CLIP	21572407
MIRT000430	hsa-miR-101-3p	PAR-CLIP	21572407
MIRT543080	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT031838	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT543079	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT543078	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT543077	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT543076	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT003899	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT543075	hsa-miR-3662	PAR-CLIP	21572407
MIRT543074	hsa-miR-3688-3p	PAR-CLIP	21572407
MIRT543073	hsa-miR-545-5p	PAR-CLIP	21572407
MIRT543072	hsa-miR-490-5p	PAR-CLIP	21572407
MIRT543071	hsa-miR-298	PAR-CLIP	21572407
MIRT543070	hsa-miR-455-3p	PAR-CLIP	21572407
MIRT084789	hsa-let-7a-2-3p	PAR-CLIP	21572407
MIRT084793	hsa-let-7g-3p	PAR-CLIP	21572407
MIRT031838	hsa-miR-16-5p	ELISA, Immunoprecipitaion, Luciferase reporter assay, qRT-PCR, Western blot	26440600
MIRT031838	hsa-miR-16-5p	ELISA, Immunoprecipitaion, Luciferase reporter assay, qRT-PCR, Western blot	26440600
MIRT543081	hsa-miR-144-3p	Luciferase reporter assay, qRT-PCR	27329039
MIRT543081	hsa-miR-144-3p	Luciferase reporter assay, qRT-PCR	27329039
MIRT732983	hsa-miR-31-5p	Immunohistochemistry (IHC), qRT-PCR	32069773
MIRT723035	hsa-miR-548ad-3p	HITS-CLIP	19536157
MIRT723034	hsa-miR-424-3p	HITS-CLIP	19536157
MIRT723033	hsa-miR-4484	HITS-CLIP	19536157
MIRT723032	hsa-miR-551b-5p	HITS-CLIP	19536157
MIRT723031	hsa-miR-3120-3p	HITS-CLIP	19536157
MIRT407081	hsa-miR-6504-3p	HITS-CLIP	19536157
MIRT710394	hsa-miR-3646	HITS-CLIP	19536157
MIRT710393	hsa-miR-6502-3p	HITS-CLIP	19536157
MIRT710392	hsa-miR-5584-5p	HITS-CLIP	19536157
MIRT549358	hsa-miR-4786-5p	HITS-CLIP	19536157
MIRT710391	hsa-miR-5093	HITS-CLIP	19536157
MIRT710389	hsa-miR-4709-3p	HITS-CLIP	19536157
MIRT705588	hsa-miR-224-3p	HITS-CLIP	23313552
MIRT705587	hsa-miR-522-3p	HITS-CLIP	23313552
MIRT705586	hsa-miR-3908	HITS-CLIP	23313552
MIRT705585	hsa-miR-197-5p	HITS-CLIP	23313552
MIRT705584	hsa-miR-3132	HITS-CLIP	23313552
MIRT705583	hsa-miR-6073	HITS-CLIP	23313552
MIRT705582	hsa-miR-3606-5p	HITS-CLIP	23313552
MIRT705581	hsa-miR-1229-5p	HITS-CLIP	23313552
MIRT660592	hsa-miR-548a-3p	HITS-CLIP	23824327
MIRT660591	hsa-miR-548ar-3p	HITS-CLIP	23824327
MIRT660590	hsa-miR-548az-3p	HITS-CLIP	23824327
MIRT660589	hsa-miR-548e-3p	HITS-CLIP	23824327
MIRT660588	hsa-miR-548f-3p	HITS-CLIP	23824327
MIRT660587	hsa-miR-5582-3p	HITS-CLIP	23824327
MIRT660586	hsa-miR-302b-5p	HITS-CLIP	23824327
MIRT660585	hsa-miR-302d-5p	HITS-CLIP	23824327
MIRT660584	hsa-miR-5696	HITS-CLIP	23824327
MIRT660583	hsa-miR-579-3p	HITS-CLIP	23824327
MIRT660582	hsa-miR-664b-3p	HITS-CLIP	23824327
MIRT660580	hsa-miR-7111-3p	HITS-CLIP	23824327
MIRT660581	hsa-miR-6780a-3p	HITS-CLIP	23824327
MIRT660579	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT660578	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT660577	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT660592	hsa-miR-548a-3p	HITS-CLIP	23824327
MIRT660591	hsa-miR-548ar-3p	HITS-CLIP	23824327
MIRT660590	hsa-miR-548az-3p	HITS-CLIP	23824327
MIRT660589	hsa-miR-548e-3p	HITS-CLIP	23824327
MIRT660588	hsa-miR-548f-3p	HITS-CLIP	23824327
MIRT660587	hsa-miR-5582-3p	HITS-CLIP	23824327
MIRT660586	hsa-miR-302b-5p	HITS-CLIP	23824327
MIRT660585	hsa-miR-302d-5p	HITS-CLIP	23824327
MIRT660584	hsa-miR-5696	HITS-CLIP	23824327
MIRT660583	hsa-miR-579-3p	HITS-CLIP	23824327
MIRT660582	hsa-miR-664b-3p	HITS-CLIP	23824327
MIRT660580	hsa-miR-7111-3p	HITS-CLIP	23824327
MIRT660581	hsa-miR-6780a-3p	HITS-CLIP	23824327
MIRT660579	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT660578	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT660577	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT559575	hsa-miR-944	PAR-CLIP	21572407
MIRT559573	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT559574	hsa-miR-567	PAR-CLIP	21572407
MIRT559572	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT559571	hsa-miR-3924	PAR-CLIP	21572407
MIRT559570	hsa-miR-297	PAR-CLIP	21572407
MIRT549363	hsa-miR-4311	PAR-CLIP	21572407
MIRT549362	hsa-miR-1276	PAR-CLIP	21572407
MIRT549361	hsa-miR-583	PAR-CLIP	21572407
MIRT549360	hsa-miR-4495	PAR-CLIP	21572407
MIRT549359	hsa-miR-4698	PAR-CLIP	21572407
MIRT549358	hsa-miR-4786-5p	PAR-CLIP	21572407
MIRT543081	hsa-miR-144-3p	PAR-CLIP	21572407
MIRT000430	hsa-miR-101-3p	PAR-CLIP	21572407
MIRT000430	hsa-miR-101-3p	PAR-CLIP	21572407
MIRT543080	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT031838	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT543079	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT543078	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT543077	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT543076	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT003899	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT543075	hsa-miR-3662	PAR-CLIP	21572407
MIRT543074	hsa-miR-3688-3p	PAR-CLIP	21572407
MIRT543073	hsa-miR-545-5p	PAR-CLIP	21572407
MIRT543072	hsa-miR-490-5p	PAR-CLIP	21572407
MIRT543071	hsa-miR-298	PAR-CLIP	21572407
MIRT543070	hsa-miR-455-3p	PAR-CLIP	21572407
MIRT084789	hsa-let-7a-2-3p	PAR-CLIP	21572407
MIRT084793	hsa-let-7g-3p	PAR-CLIP	21572407
MIRT790682	hsa-miR-101	CLIP-seq
MIRT790683	hsa-miR-106a	CLIP-seq
MIRT790684	hsa-miR-106b	CLIP-seq
MIRT790685	hsa-miR-1260	CLIP-seq
MIRT790686	hsa-miR-1264	CLIP-seq
MIRT790687	hsa-miR-1270	CLIP-seq
MIRT790688	hsa-miR-1273d	CLIP-seq
MIRT790689	hsa-miR-1297	CLIP-seq
MIRT790690	hsa-miR-144	CLIP-seq
MIRT790691	hsa-miR-147	CLIP-seq
MIRT790692	hsa-miR-15a	CLIP-seq
MIRT790693	hsa-miR-15b	CLIP-seq
MIRT790694	hsa-miR-16	CLIP-seq
MIRT790695	hsa-miR-17	CLIP-seq
MIRT790696	hsa-miR-188-3p	CLIP-seq
MIRT790697	hsa-miR-195	CLIP-seq
MIRT790698	hsa-miR-2052	CLIP-seq
MIRT790699	hsa-miR-20a	CLIP-seq
MIRT790700	hsa-miR-20b	CLIP-seq
MIRT790701	hsa-miR-216b	CLIP-seq
MIRT790702	hsa-miR-23a	CLIP-seq
MIRT790703	hsa-miR-23b	CLIP-seq
MIRT790704	hsa-miR-23c	CLIP-seq
MIRT790705	hsa-miR-26a	CLIP-seq
MIRT790706	hsa-miR-26b	CLIP-seq
MIRT790707	hsa-miR-300	CLIP-seq
MIRT790708	hsa-miR-302a	CLIP-seq
MIRT790709	hsa-miR-302b	CLIP-seq
MIRT790710	hsa-miR-302c	CLIP-seq
MIRT790711	hsa-miR-302d	CLIP-seq
MIRT790712	hsa-miR-302e	CLIP-seq
MIRT790713	hsa-miR-3074-3p	CLIP-seq
MIRT790714	hsa-miR-31	CLIP-seq
MIRT790715	hsa-miR-3148	CLIP-seq
MIRT790716	hsa-miR-3156-3p	CLIP-seq
MIRT790717	hsa-miR-3158-5p	CLIP-seq
MIRT790718	hsa-miR-323-3p	CLIP-seq
MIRT790719	hsa-miR-324-5p	CLIP-seq
MIRT790720	hsa-miR-337-3p	CLIP-seq
MIRT790721	hsa-miR-3606	CLIP-seq
MIRT790722	hsa-miR-361-3p	CLIP-seq
MIRT790723	hsa-miR-3647-3p	CLIP-seq
MIRT790724	hsa-miR-3663-3p	CLIP-seq
MIRT790725	hsa-miR-3686	CLIP-seq
MIRT790726	hsa-miR-3689a-5p	CLIP-seq
MIRT790727	hsa-miR-3689b	CLIP-seq
MIRT790728	hsa-miR-3689e	CLIP-seq
MIRT790729	hsa-miR-3689f	CLIP-seq
MIRT790730	hsa-miR-3691-5p	CLIP-seq
MIRT790731	hsa-miR-3713	CLIP-seq
MIRT790732	hsa-miR-372	CLIP-seq
MIRT790733	hsa-miR-373	CLIP-seq
MIRT790734	hsa-miR-381	CLIP-seq
MIRT790735	hsa-miR-3911	CLIP-seq
MIRT790736	hsa-miR-3936	CLIP-seq
MIRT790737	hsa-miR-3976	CLIP-seq
MIRT790738	hsa-miR-424	CLIP-seq
MIRT790739	hsa-miR-4269	CLIP-seq
MIRT790740	hsa-miR-4286	CLIP-seq
MIRT790741	hsa-miR-431	CLIP-seq
MIRT790742	hsa-miR-4422	CLIP-seq
MIRT790743	hsa-miR-4423-3p	CLIP-seq
MIRT790744	hsa-miR-4434	CLIP-seq
MIRT790745	hsa-miR-4465	CLIP-seq
MIRT790746	hsa-miR-4489	CLIP-seq
MIRT790747	hsa-miR-4501	CLIP-seq
MIRT790748	hsa-miR-4509	CLIP-seq
MIRT790749	hsa-miR-4514	CLIP-seq
MIRT790750	hsa-miR-4516	CLIP-seq
MIRT790751	hsa-miR-4530	CLIP-seq
MIRT790752	hsa-miR-4531	CLIP-seq
MIRT790753	hsa-miR-4532	CLIP-seq
MIRT790754	hsa-miR-4539	CLIP-seq
MIRT790755	hsa-miR-4659a-3p	CLIP-seq
MIRT790756	hsa-miR-4659b-3p	CLIP-seq
MIRT790757	hsa-miR-4666-3p	CLIP-seq
MIRT790758	hsa-miR-4680-5p	CLIP-seq
MIRT790759	hsa-miR-4692	CLIP-seq
MIRT790760	hsa-miR-4694-3p	CLIP-seq
MIRT790761	hsa-miR-4717-3p	CLIP-seq
MIRT790762	hsa-miR-4719	CLIP-seq
MIRT790763	hsa-miR-4731-3p	CLIP-seq
MIRT790764	hsa-miR-4742-5p	CLIP-seq
MIRT790765	hsa-miR-4744	CLIP-seq
MIRT790766	hsa-miR-4752	CLIP-seq
MIRT790767	hsa-miR-4760-3p	CLIP-seq
MIRT790768	hsa-miR-4766-5p	CLIP-seq
MIRT790769	hsa-miR-4775	CLIP-seq
MIRT790770	hsa-miR-4778-5p	CLIP-seq
MIRT790771	hsa-miR-4793-5p	CLIP-seq
MIRT790772	hsa-miR-4794	CLIP-seq
MIRT790773	hsa-miR-4801	CLIP-seq
MIRT790774	hsa-miR-497	CLIP-seq
MIRT790775	hsa-miR-519d	CLIP-seq
MIRT790776	hsa-miR-520a-3p	CLIP-seq
MIRT790777	hsa-miR-520b	CLIP-seq
MIRT790778	hsa-miR-520d-3p	CLIP-seq
MIRT790779	hsa-miR-520e	CLIP-seq
MIRT790780	hsa-miR-520f	CLIP-seq
MIRT790781	hsa-miR-522	CLIP-seq
MIRT790782	hsa-miR-548ad	CLIP-seq
MIRT790783	hsa-miR-548c-3p	CLIP-seq
MIRT790784	hsa-miR-548n	CLIP-seq
MIRT790785	hsa-miR-548t	CLIP-seq
MIRT790786	hsa-miR-582-5p	CLIP-seq
MIRT790787	hsa-miR-620	CLIP-seq
MIRT790788	hsa-miR-634	CLIP-seq
MIRT790789	hsa-miR-644	CLIP-seq
MIRT790790	hsa-miR-646	CLIP-seq
MIRT790791	hsa-miR-660	CLIP-seq
MIRT790792	hsa-miR-662	CLIP-seq
MIRT790793	hsa-miR-664	CLIP-seq
MIRT790794	hsa-miR-892b	CLIP-seq
MIRT790795	hsa-miR-922	CLIP-seq
MIRT790796	hsa-miR-93	CLIP-seq
MIRT790689	hsa-miR-1297	CLIP-seq
MIRT790691	hsa-miR-147	CLIP-seq
MIRT790705	hsa-miR-26a	CLIP-seq
MIRT790706	hsa-miR-26b	CLIP-seq
MIRT790730	hsa-miR-3691-5p	CLIP-seq
MIRT790735	hsa-miR-3911	CLIP-seq
MIRT790739	hsa-miR-4269	CLIP-seq
MIRT790745	hsa-miR-4465	CLIP-seq
MIRT790749	hsa-miR-4514	CLIP-seq
MIRT790759	hsa-miR-4692	CLIP-seq
MIRT790764	hsa-miR-4742-5p	CLIP-seq
MIRT790766	hsa-miR-4752	CLIP-seq
MIRT790767	hsa-miR-4760-3p	CLIP-seq
MIRT790789	hsa-miR-644	CLIP-seq
MIRT790682	hsa-miR-101	CLIP-seq
MIRT790683	hsa-miR-106a	CLIP-seq
MIRT790684	hsa-miR-106b	CLIP-seq
MIRT790686	hsa-miR-1264	CLIP-seq
MIRT790687	hsa-miR-1270	CLIP-seq
MIRT790689	hsa-miR-1297	CLIP-seq
MIRT790690	hsa-miR-144	CLIP-seq
MIRT790691	hsa-miR-147	CLIP-seq
MIRT790692	hsa-miR-15a	CLIP-seq
MIRT790693	hsa-miR-15b	CLIP-seq
MIRT790694	hsa-miR-16	CLIP-seq
MIRT790695	hsa-miR-17	CLIP-seq
MIRT790697	hsa-miR-195	CLIP-seq
MIRT790797	hsa-miR-205	CLIP-seq
MIRT790698	hsa-miR-2052	CLIP-seq
MIRT790798	hsa-miR-2054	CLIP-seq
MIRT790699	hsa-miR-20a	CLIP-seq
MIRT790700	hsa-miR-20b	CLIP-seq
MIRT790705	hsa-miR-26a	CLIP-seq
MIRT790706	hsa-miR-26b	CLIP-seq
MIRT790707	hsa-miR-300	CLIP-seq
MIRT790708	hsa-miR-302a	CLIP-seq
MIRT790709	hsa-miR-302b	CLIP-seq
MIRT790710	hsa-miR-302c	CLIP-seq
MIRT790711	hsa-miR-302d	CLIP-seq
MIRT790712	hsa-miR-302e	CLIP-seq
MIRT790799	hsa-miR-3137	CLIP-seq
MIRT790800	hsa-miR-3152-3p	CLIP-seq
MIRT790717	hsa-miR-3158-5p	CLIP-seq
MIRT790723	hsa-miR-3647-3p	CLIP-seq
MIRT790725	hsa-miR-3686	CLIP-seq
MIRT790730	hsa-miR-3691-5p	CLIP-seq
MIRT790732	hsa-miR-372	CLIP-seq
MIRT790733	hsa-miR-373	CLIP-seq
MIRT790801	hsa-miR-374c	CLIP-seq
MIRT790802	hsa-miR-380	CLIP-seq
MIRT790734	hsa-miR-381	CLIP-seq
MIRT790735	hsa-miR-3911	CLIP-seq
MIRT790736	hsa-miR-3936	CLIP-seq
MIRT790738	hsa-miR-424	CLIP-seq
MIRT790803	hsa-miR-4257	CLIP-seq
MIRT790739	hsa-miR-4269	CLIP-seq
MIRT790804	hsa-miR-4280	CLIP-seq
MIRT790741	hsa-miR-431	CLIP-seq
MIRT790744	hsa-miR-4434	CLIP-seq
MIRT790745	hsa-miR-4465	CLIP-seq
MIRT790746	hsa-miR-4489	CLIP-seq
MIRT790747	hsa-miR-4501	CLIP-seq
MIRT790749	hsa-miR-4514	CLIP-seq
MIRT790750	hsa-miR-4516	CLIP-seq
MIRT790752	hsa-miR-4531	CLIP-seq
MIRT790753	hsa-miR-4532	CLIP-seq
MIRT790757	hsa-miR-4666-3p	CLIP-seq
MIRT790759	hsa-miR-4692	CLIP-seq
MIRT790762	hsa-miR-4719	CLIP-seq
MIRT790763	hsa-miR-4731-3p	CLIP-seq
MIRT790764	hsa-miR-4742-5p	CLIP-seq
MIRT790766	hsa-miR-4752	CLIP-seq
MIRT790767	hsa-miR-4760-3p	CLIP-seq
MIRT790769	hsa-miR-4775	CLIP-seq
MIRT790770	hsa-miR-4778-5p	CLIP-seq
MIRT790771	hsa-miR-4793-5p	CLIP-seq
MIRT790772	hsa-miR-4794	CLIP-seq
MIRT790773	hsa-miR-4801	CLIP-seq
MIRT790805	hsa-miR-485-5p	CLIP-seq
MIRT790774	hsa-miR-497	CLIP-seq
MIRT790775	hsa-miR-519d	CLIP-seq
MIRT790776	hsa-miR-520a-3p	CLIP-seq
MIRT790777	hsa-miR-520b	CLIP-seq
MIRT790778	hsa-miR-520d-3p	CLIP-seq
MIRT790779	hsa-miR-520e	CLIP-seq
MIRT790780	hsa-miR-520f	CLIP-seq
MIRT790784	hsa-miR-548n	CLIP-seq
MIRT790785	hsa-miR-548t	CLIP-seq
MIRT790806	hsa-miR-581	CLIP-seq
MIRT790786	hsa-miR-582-5p	CLIP-seq
MIRT790787	hsa-miR-620	CLIP-seq
MIRT790807	hsa-miR-626	CLIP-seq
MIRT790789	hsa-miR-644	CLIP-seq
MIRT790808	hsa-miR-654-3p	CLIP-seq
MIRT790809	hsa-miR-655	CLIP-seq
MIRT790794	hsa-miR-892b	CLIP-seq
MIRT790796	hsa-miR-93	CLIP-seq
MIRT790762	hsa-miR-4719	CLIP-seq
MIRT790682	hsa-miR-101	CLIP-seq
MIRT790690	hsa-miR-144	CLIP-seq
MIRT790707	hsa-miR-300	CLIP-seq
MIRT790721	hsa-miR-3606	CLIP-seq
MIRT790726	hsa-miR-3689a-5p	CLIP-seq
MIRT790727	hsa-miR-3689b	CLIP-seq
MIRT790728	hsa-miR-3689e	CLIP-seq
MIRT790729	hsa-miR-3689f	CLIP-seq
MIRT790734	hsa-miR-381	CLIP-seq
MIRT790736	hsa-miR-3936	CLIP-seq
MIRT790803	hsa-miR-4257	CLIP-seq
MIRT790739	hsa-miR-4269	CLIP-seq
MIRT790742	hsa-miR-4422	CLIP-seq
MIRT790746	hsa-miR-4489	CLIP-seq
MIRT790747	hsa-miR-4501	CLIP-seq
MIRT790757	hsa-miR-4666-3p	CLIP-seq
MIRT790762	hsa-miR-4719	CLIP-seq
MIRT790771	hsa-miR-4793-5p	CLIP-seq
MIRT790772	hsa-miR-4794	CLIP-seq
MIRT790805	hsa-miR-485-5p	CLIP-seq
MIRT790807	hsa-miR-626	CLIP-seq
MIRT790794	hsa-miR-892b	CLIP-seq
MIRT790682	hsa-miR-101	CLIP-seq
MIRT2173405	hsa-miR-1245	CLIP-seq
MIRT790685	hsa-miR-1260	CLIP-seq
MIRT790686	hsa-miR-1264	CLIP-seq
MIRT790687	hsa-miR-1270	CLIP-seq
MIRT790688	hsa-miR-1273d	CLIP-seq
MIRT790690	hsa-miR-144	CLIP-seq
MIRT790691	hsa-miR-147	CLIP-seq
MIRT790692	hsa-miR-15a	CLIP-seq
MIRT790693	hsa-miR-15b	CLIP-seq
MIRT790694	hsa-miR-16	CLIP-seq
MIRT790696	hsa-miR-188-3p	CLIP-seq
MIRT790697	hsa-miR-195	CLIP-seq
MIRT790797	hsa-miR-205	CLIP-seq
MIRT790698	hsa-miR-2052	CLIP-seq
MIRT790701	hsa-miR-216b	CLIP-seq
MIRT790702	hsa-miR-23a	CLIP-seq
MIRT790703	hsa-miR-23b	CLIP-seq
MIRT790704	hsa-miR-23c	CLIP-seq
MIRT790707	hsa-miR-300	CLIP-seq
MIRT790713	hsa-miR-3074-3p	CLIP-seq
MIRT790714	hsa-miR-31	CLIP-seq
MIRT2173406	hsa-miR-3117-3p	CLIP-seq
MIRT2173407	hsa-miR-3123	CLIP-seq
MIRT790799	hsa-miR-3137	CLIP-seq
MIRT790715	hsa-miR-3148	CLIP-seq
MIRT790800	hsa-miR-3152-3p	CLIP-seq
MIRT790716	hsa-miR-3156-3p	CLIP-seq
MIRT790717	hsa-miR-3158-5p	CLIP-seq
MIRT2173408	hsa-miR-3169	CLIP-seq
MIRT790718	hsa-miR-323-3p	CLIP-seq
MIRT790719	hsa-miR-324-5p	CLIP-seq
MIRT790720	hsa-miR-337-3p	CLIP-seq
MIRT790722	hsa-miR-361-3p	CLIP-seq
MIRT2173409	hsa-miR-3616-5p	CLIP-seq
MIRT2173410	hsa-miR-3622a-5p	CLIP-seq
MIRT790723	hsa-miR-3647-3p	CLIP-seq
MIRT2173411	hsa-miR-3647-5p	CLIP-seq
MIRT790724	hsa-miR-3663-3p	CLIP-seq
MIRT790725	hsa-miR-3686	CLIP-seq
MIRT790726	hsa-miR-3689a-5p	CLIP-seq
MIRT790727	hsa-miR-3689b	CLIP-seq
MIRT790728	hsa-miR-3689e	CLIP-seq
MIRT790729	hsa-miR-3689f	CLIP-seq
MIRT790730	hsa-miR-3691-5p	CLIP-seq
MIRT790731	hsa-miR-3713	CLIP-seq
MIRT790801	hsa-miR-374c	CLIP-seq
MIRT790802	hsa-miR-380	CLIP-seq
MIRT790734	hsa-miR-381	CLIP-seq
MIRT2173412	hsa-miR-383	CLIP-seq
MIRT790735	hsa-miR-3911	CLIP-seq
MIRT790736	hsa-miR-3936	CLIP-seq
MIRT790737	hsa-miR-3976	CLIP-seq
MIRT790738	hsa-miR-424	CLIP-seq
MIRT790739	hsa-miR-4269	CLIP-seq
MIRT790804	hsa-miR-4280	CLIP-seq
MIRT790740	hsa-miR-4286	CLIP-seq
MIRT790741	hsa-miR-431	CLIP-seq
MIRT790742	hsa-miR-4422	CLIP-seq
MIRT790743	hsa-miR-4423-3p	CLIP-seq
MIRT790744	hsa-miR-4434	CLIP-seq
MIRT790746	hsa-miR-4489	CLIP-seq
MIRT790747	hsa-miR-4501	CLIP-seq
MIRT790748	hsa-miR-4509	CLIP-seq
MIRT790749	hsa-miR-4514	CLIP-seq
MIRT790750	hsa-miR-4516	CLIP-seq
MIRT790751	hsa-miR-4530	CLIP-seq
MIRT790752	hsa-miR-4531	CLIP-seq
MIRT790753	hsa-miR-4532	CLIP-seq
MIRT790754	hsa-miR-4539	CLIP-seq
MIRT2173413	hsa-miR-4635	CLIP-seq
MIRT790755	hsa-miR-4659a-3p	CLIP-seq
MIRT790756	hsa-miR-4659b-3p	CLIP-seq
MIRT790757	hsa-miR-4666-3p	CLIP-seq
MIRT790758	hsa-miR-4680-5p	CLIP-seq
MIRT790759	hsa-miR-4692	CLIP-seq
MIRT790761	hsa-miR-4717-3p	CLIP-seq
MIRT790762	hsa-miR-4719	CLIP-seq
MIRT790763	hsa-miR-4731-3p	CLIP-seq
MIRT790764	hsa-miR-4742-5p	CLIP-seq
MIRT790765	hsa-miR-4744	CLIP-seq
MIRT790766	hsa-miR-4752	CLIP-seq
MIRT2173414	hsa-miR-4759	CLIP-seq
MIRT2173415	hsa-miR-4772-5p	CLIP-seq
MIRT790769	hsa-miR-4775	CLIP-seq
MIRT790770	hsa-miR-4778-5p	CLIP-seq
MIRT790771	hsa-miR-4793-5p	CLIP-seq
MIRT790772	hsa-miR-4794	CLIP-seq
MIRT790773	hsa-miR-4801	CLIP-seq
MIRT2173416	hsa-miR-495	CLIP-seq
MIRT790774	hsa-miR-497	CLIP-seq
MIRT2173417	hsa-miR-548a-5p	CLIP-seq
MIRT2173418	hsa-miR-548ab	CLIP-seq
MIRT790782	hsa-miR-548ad	CLIP-seq
MIRT2173419	hsa-miR-548ak	CLIP-seq
MIRT2173420	hsa-miR-548b-5p	CLIP-seq
MIRT790783	hsa-miR-548c-3p	CLIP-seq
MIRT2173421	hsa-miR-548c-5p	CLIP-seq
MIRT2173422	hsa-miR-548d-5p	CLIP-seq
MIRT2173423	hsa-miR-548h	CLIP-seq
MIRT2173424	hsa-miR-548i	CLIP-seq
MIRT2173425	hsa-miR-548j	CLIP-seq
MIRT2173426	hsa-miR-548k	CLIP-seq
MIRT2173427	hsa-miR-548l	CLIP-seq
MIRT2173428	hsa-miR-548w	CLIP-seq
MIRT2173429	hsa-miR-548y	CLIP-seq
MIRT2173430	hsa-miR-559	CLIP-seq
MIRT2173431	hsa-miR-573	CLIP-seq
MIRT790806	hsa-miR-581	CLIP-seq
MIRT790786	hsa-miR-582-5p	CLIP-seq
MIRT790787	hsa-miR-620	CLIP-seq
MIRT790788	hsa-miR-634	CLIP-seq
MIRT790789	hsa-miR-644	CLIP-seq
MIRT790790	hsa-miR-646	CLIP-seq
MIRT790808	hsa-miR-654-3p	CLIP-seq
MIRT790809	hsa-miR-655	CLIP-seq
MIRT790791	hsa-miR-660	CLIP-seq
MIRT790792	hsa-miR-662	CLIP-seq
MIRT790793	hsa-miR-664	CLIP-seq
MIRT2173432	hsa-miR-873	CLIP-seq
MIRT790794	hsa-miR-892b	CLIP-seq
MIRT790795	hsa-miR-922	CLIP-seq
MIRT790682	hsa-miR-101	CLIP-seq
MIRT790689	hsa-miR-1297	CLIP-seq
MIRT790690	hsa-miR-144	CLIP-seq
MIRT790691	hsa-miR-147	CLIP-seq
MIRT790692	hsa-miR-15a	CLIP-seq
MIRT790693	hsa-miR-15b	CLIP-seq
MIRT790694	hsa-miR-16	CLIP-seq
MIRT790697	hsa-miR-195	CLIP-seq
MIRT790705	hsa-miR-26a	CLIP-seq
MIRT790706	hsa-miR-26b	CLIP-seq
MIRT790730	hsa-miR-3691-5p	CLIP-seq
MIRT790735	hsa-miR-3911	CLIP-seq
MIRT790738	hsa-miR-424	CLIP-seq
MIRT790739	hsa-miR-4269	CLIP-seq
MIRT790745	hsa-miR-4465	CLIP-seq
MIRT790749	hsa-miR-4514	CLIP-seq
MIRT790759	hsa-miR-4692	CLIP-seq
MIRT790762	hsa-miR-4719	CLIP-seq
MIRT790764	hsa-miR-4742-5p	CLIP-seq
MIRT790766	hsa-miR-4752	CLIP-seq
MIRT790767	hsa-miR-4760-3p	CLIP-seq
MIRT790774	hsa-miR-497	CLIP-seq
MIRT790789	hsa-miR-644	CLIP-seq
MIRT790682	hsa-miR-101	CLIP-seq
MIRT790688	hsa-miR-1273d	CLIP-seq
MIRT790689	hsa-miR-1297	CLIP-seq
MIRT790690	hsa-miR-144	CLIP-seq
MIRT790692	hsa-miR-15a	CLIP-seq
MIRT790693	hsa-miR-15b	CLIP-seq
MIRT790694	hsa-miR-16	CLIP-seq
MIRT790697	hsa-miR-195	CLIP-seq
MIRT790798	hsa-miR-2054	CLIP-seq
MIRT790705	hsa-miR-26a	CLIP-seq
MIRT790706	hsa-miR-26b	CLIP-seq
MIRT790713	hsa-miR-3074-3p	CLIP-seq
MIRT790715	hsa-miR-3148	CLIP-seq
MIRT790800	hsa-miR-3152-3p	CLIP-seq
MIRT790717	hsa-miR-3158-5p	CLIP-seq
MIRT790720	hsa-miR-337-3p	CLIP-seq
MIRT2173410	hsa-miR-3622a-5p	CLIP-seq
MIRT790723	hsa-miR-3647-3p	CLIP-seq
MIRT790725	hsa-miR-3686	CLIP-seq
MIRT790731	hsa-miR-3713	CLIP-seq
MIRT790801	hsa-miR-374c	CLIP-seq
MIRT790802	hsa-miR-380	CLIP-seq
MIRT790737	hsa-miR-3976	CLIP-seq
MIRT790738	hsa-miR-424	CLIP-seq
MIRT790739	hsa-miR-4269	CLIP-seq
MIRT790804	hsa-miR-4280	CLIP-seq
MIRT790742	hsa-miR-4422	CLIP-seq
MIRT790745	hsa-miR-4465	CLIP-seq
MIRT790749	hsa-miR-4514	CLIP-seq
MIRT790759	hsa-miR-4692	CLIP-seq
MIRT790762	hsa-miR-4719	CLIP-seq
MIRT790763	hsa-miR-4731-3p	CLIP-seq
MIRT790764	hsa-miR-4742-5p	CLIP-seq
MIRT790767	hsa-miR-4760-3p	CLIP-seq
MIRT790770	hsa-miR-4778-5p	CLIP-seq
MIRT790771	hsa-miR-4793-5p	CLIP-seq
MIRT790773	hsa-miR-4801	CLIP-seq
MIRT2173416	hsa-miR-495	CLIP-seq
MIRT790774	hsa-miR-497	CLIP-seq
MIRT790806	hsa-miR-581	CLIP-seq
MIRT790786	hsa-miR-582-5p	CLIP-seq
MIRT790809	hsa-miR-655	CLIP-seq
MIRT790791	hsa-miR-660	CLIP-seq
MIRT790702	hsa-miR-23a	CLIP-seq
MIRT790703	hsa-miR-23b	CLIP-seq
MIRT790704	hsa-miR-23c	CLIP-seq
MIRT2173406	hsa-miR-3117-3p	CLIP-seq
MIRT2173408	hsa-miR-3169	CLIP-seq
MIRT790719	hsa-miR-324-5p	CLIP-seq
MIRT790722	hsa-miR-361-3p	CLIP-seq
MIRT790802	hsa-miR-380	CLIP-seq
MIRT790742	hsa-miR-4422	CLIP-seq
MIRT790761	hsa-miR-4717-3p	CLIP-seq
MIRT2173414	hsa-miR-4759	CLIP-seq
MIRT2173417	hsa-miR-548a-5p	CLIP-seq
MIRT2173418	hsa-miR-548ab	CLIP-seq
MIRT2173419	hsa-miR-548ak	CLIP-seq
MIRT2173420	hsa-miR-548b-5p	CLIP-seq
MIRT2173421	hsa-miR-548c-5p	CLIP-seq
MIRT2173422	hsa-miR-548d-5p	CLIP-seq
MIRT2173423	hsa-miR-548h	CLIP-seq
MIRT2173424	hsa-miR-548i	CLIP-seq
MIRT2173425	hsa-miR-548j	CLIP-seq
MIRT2173426	hsa-miR-548k	CLIP-seq
MIRT2173427	hsa-miR-548l	CLIP-seq
MIRT2173428	hsa-miR-548w	CLIP-seq
MIRT2173429	hsa-miR-548y	CLIP-seq
MIRT2173430	hsa-miR-559	CLIP-seq
MIRT790792	hsa-miR-662	CLIP-seq
MIRT790682	hsa-miR-101	CLIP-seq
MIRT790686	hsa-miR-1264	CLIP-seq
MIRT790690	hsa-miR-144	CLIP-seq
MIRT2476983	hsa-miR-153	CLIP-seq
MIRT790692	hsa-miR-15a	CLIP-seq
MIRT790693	hsa-miR-15b	CLIP-seq
MIRT790694	hsa-miR-16	CLIP-seq
MIRT2476984	hsa-miR-185	CLIP-seq
MIRT2476985	hsa-miR-186	CLIP-seq
MIRT790697	hsa-miR-195	CLIP-seq
MIRT790797	hsa-miR-205	CLIP-seq
MIRT790701	hsa-miR-216b	CLIP-seq
MIRT790702	hsa-miR-23a	CLIP-seq
MIRT790703	hsa-miR-23b	CLIP-seq
MIRT790704	hsa-miR-23c	CLIP-seq
MIRT790707	hsa-miR-300	CLIP-seq
MIRT790713	hsa-miR-3074-3p	CLIP-seq
MIRT2173406	hsa-miR-3117-3p	CLIP-seq
MIRT2173407	hsa-miR-3123	CLIP-seq
MIRT2476986	hsa-miR-3133	CLIP-seq
MIRT790799	hsa-miR-3137	CLIP-seq
MIRT790715	hsa-miR-3148	CLIP-seq
MIRT2173408	hsa-miR-3169	CLIP-seq
MIRT790719	hsa-miR-324-5p	CLIP-seq
MIRT790720	hsa-miR-337-3p	CLIP-seq
MIRT790722	hsa-miR-361-3p	CLIP-seq
MIRT2173410	hsa-miR-3622a-5p	CLIP-seq
MIRT790723	hsa-miR-3647-3p	CLIP-seq
MIRT2476987	hsa-miR-3667-5p	CLIP-seq
MIRT2476988	hsa-miR-3682-5p	CLIP-seq
MIRT790726	hsa-miR-3689a-5p	CLIP-seq
MIRT790727	hsa-miR-3689b	CLIP-seq
MIRT790728	hsa-miR-3689e	CLIP-seq
MIRT790729	hsa-miR-3689f	CLIP-seq
MIRT790731	hsa-miR-3713	CLIP-seq
MIRT790802	hsa-miR-380	CLIP-seq
MIRT790734	hsa-miR-381	CLIP-seq
MIRT790736	hsa-miR-3936	CLIP-seq
MIRT790738	hsa-miR-424	CLIP-seq
MIRT790740	hsa-miR-4286	CLIP-seq
MIRT2476989	hsa-miR-4306	CLIP-seq
MIRT790741	hsa-miR-431	CLIP-seq
MIRT790742	hsa-miR-4422	CLIP-seq
MIRT2476990	hsa-miR-4433	CLIP-seq
MIRT2476991	hsa-miR-4459	CLIP-seq
MIRT2476992	hsa-miR-4463	CLIP-seq
MIRT790746	hsa-miR-4489	CLIP-seq
MIRT2476993	hsa-miR-4494	CLIP-seq
MIRT790747	hsa-miR-4501	CLIP-seq
MIRT790748	hsa-miR-4509	CLIP-seq
MIRT790753	hsa-miR-4532	CLIP-seq
MIRT2476994	hsa-miR-4644	CLIP-seq
MIRT790757	hsa-miR-4666-3p	CLIP-seq
MIRT2476995	hsa-miR-4713-5p	CLIP-seq
MIRT790761	hsa-miR-4717-3p	CLIP-seq
MIRT790762	hsa-miR-4719	CLIP-seq
MIRT790763	hsa-miR-4731-3p	CLIP-seq
MIRT2476996	hsa-miR-4738-3p	CLIP-seq
MIRT790765	hsa-miR-4744	CLIP-seq
MIRT2173414	hsa-miR-4759	CLIP-seq
MIRT790768	hsa-miR-4766-5p	CLIP-seq
MIRT2476997	hsa-miR-4768-3p	CLIP-seq
MIRT790771	hsa-miR-4793-5p	CLIP-seq
MIRT790772	hsa-miR-4794	CLIP-seq
MIRT790773	hsa-miR-4801	CLIP-seq
MIRT2173416	hsa-miR-495	CLIP-seq
MIRT790774	hsa-miR-497	CLIP-seq
MIRT2476998	hsa-miR-499a-5p	CLIP-seq
MIRT2173417	hsa-miR-548a-5p	CLIP-seq
MIRT2173418	hsa-miR-548ab	CLIP-seq
MIRT2173419	hsa-miR-548ak	CLIP-seq
MIRT2173420	hsa-miR-548b-5p	CLIP-seq
MIRT790783	hsa-miR-548c-3p	CLIP-seq
MIRT2173421	hsa-miR-548c-5p	CLIP-seq
MIRT2173422	hsa-miR-548d-5p	CLIP-seq
MIRT2173423	hsa-miR-548h	CLIP-seq
MIRT2173424	hsa-miR-548i	CLIP-seq
MIRT2173425	hsa-miR-548j	CLIP-seq
MIRT2173426	hsa-miR-548k	CLIP-seq
MIRT2173427	hsa-miR-548l	CLIP-seq
MIRT2173428	hsa-miR-548w	CLIP-seq
MIRT2173429	hsa-miR-548y	CLIP-seq
MIRT2173430	hsa-miR-559	CLIP-seq
MIRT790786	hsa-miR-582-5p	CLIP-seq
MIRT790808	hsa-miR-654-3p	CLIP-seq
MIRT790792	hsa-miR-662	CLIP-seq
MIRT790793	hsa-miR-664	CLIP-seq
MIRT790794	hsa-miR-892b	CLIP-seq
MIRT2476999	hsa-miR-942	CLIP-seq
MIRT790682	hsa-miR-101	CLIP-seq
MIRT790686	hsa-miR-1264	CLIP-seq
MIRT790690	hsa-miR-144	CLIP-seq
MIRT790692	hsa-miR-15a	CLIP-seq
MIRT790693	hsa-miR-15b	CLIP-seq
MIRT790694	hsa-miR-16	CLIP-seq
MIRT2476984	hsa-miR-185	CLIP-seq
MIRT2476985	hsa-miR-186	CLIP-seq
MIRT790697	hsa-miR-195	CLIP-seq
MIRT790797	hsa-miR-205	CLIP-seq
MIRT790701	hsa-miR-216b	CLIP-seq
MIRT790702	hsa-miR-23a	CLIP-seq
MIRT790703	hsa-miR-23b	CLIP-seq
MIRT790704	hsa-miR-23c	CLIP-seq
MIRT790707	hsa-miR-300	CLIP-seq
MIRT790713	hsa-miR-3074-3p	CLIP-seq
MIRT2173406	hsa-miR-3117-3p	CLIP-seq
MIRT2173407	hsa-miR-3123	CLIP-seq
MIRT2476986	hsa-miR-3133	CLIP-seq
MIRT790799	hsa-miR-3137	CLIP-seq
MIRT790715	hsa-miR-3148	CLIP-seq
MIRT2173408	hsa-miR-3169	CLIP-seq
MIRT790719	hsa-miR-324-5p	CLIP-seq
MIRT790720	hsa-miR-337-3p	CLIP-seq
MIRT790722	hsa-miR-361-3p	CLIP-seq
MIRT2173410	hsa-miR-3622a-5p	CLIP-seq
MIRT790723	hsa-miR-3647-3p	CLIP-seq
MIRT2476987	hsa-miR-3667-5p	CLIP-seq
MIRT2476988	hsa-miR-3682-5p	CLIP-seq
MIRT790726	hsa-miR-3689a-5p	CLIP-seq
MIRT790727	hsa-miR-3689b	CLIP-seq
MIRT790728	hsa-miR-3689e	CLIP-seq
MIRT790729	hsa-miR-3689f	CLIP-seq
MIRT790731	hsa-miR-3713	CLIP-seq
MIRT790802	hsa-miR-380	CLIP-seq
MIRT790734	hsa-miR-381	CLIP-seq
MIRT790736	hsa-miR-3936	CLIP-seq
MIRT790738	hsa-miR-424	CLIP-seq
MIRT790740	hsa-miR-4286	CLIP-seq
MIRT2476989	hsa-miR-4306	CLIP-seq
MIRT790741	hsa-miR-431	CLIP-seq
MIRT790742	hsa-miR-4422	CLIP-seq
MIRT2476990	hsa-miR-4433	CLIP-seq
MIRT2476991	hsa-miR-4459	CLIP-seq
MIRT2476992	hsa-miR-4463	CLIP-seq
MIRT790746	hsa-miR-4489	CLIP-seq
MIRT2476993	hsa-miR-4494	CLIP-seq
MIRT790747	hsa-miR-4501	CLIP-seq
MIRT790748	hsa-miR-4509	CLIP-seq
MIRT790753	hsa-miR-4532	CLIP-seq
MIRT2476994	hsa-miR-4644	CLIP-seq
MIRT790757	hsa-miR-4666-3p	CLIP-seq
MIRT2476995	hsa-miR-4713-5p	CLIP-seq
MIRT790761	hsa-miR-4717-3p	CLIP-seq
MIRT790762	hsa-miR-4719	CLIP-seq
MIRT2476996	hsa-miR-4738-3p	CLIP-seq
MIRT790765	hsa-miR-4744	CLIP-seq
MIRT2173414	hsa-miR-4759	CLIP-seq
MIRT790768	hsa-miR-4766-5p	CLIP-seq
MIRT2476997	hsa-miR-4768-3p	CLIP-seq
MIRT790769	hsa-miR-4775	CLIP-seq
MIRT790771	hsa-miR-4793-5p	CLIP-seq
MIRT790772	hsa-miR-4794	CLIP-seq
MIRT2173416	hsa-miR-495	CLIP-seq
MIRT790774	hsa-miR-497	CLIP-seq
MIRT2476998	hsa-miR-499a-5p	CLIP-seq
MIRT2173417	hsa-miR-548a-5p	CLIP-seq
MIRT2173418	hsa-miR-548ab	CLIP-seq
MIRT2173419	hsa-miR-548ak	CLIP-seq
MIRT2173420	hsa-miR-548b-5p	CLIP-seq
MIRT790783	hsa-miR-548c-3p	CLIP-seq
MIRT2173421	hsa-miR-548c-5p	CLIP-seq
MIRT2173422	hsa-miR-548d-5p	CLIP-seq
MIRT2173423	hsa-miR-548h	CLIP-seq
MIRT2173424	hsa-miR-548i	CLIP-seq
MIRT2173425	hsa-miR-548j	CLIP-seq
MIRT2173426	hsa-miR-548k	CLIP-seq
MIRT2173427	hsa-miR-548l	CLIP-seq
MIRT2173428	hsa-miR-548w	CLIP-seq
MIRT2173429	hsa-miR-548y	CLIP-seq
MIRT2173430	hsa-miR-559	CLIP-seq
MIRT790786	hsa-miR-582-5p	CLIP-seq
MIRT790808	hsa-miR-654-3p	CLIP-seq
MIRT790792	hsa-miR-662	CLIP-seq
MIRT790793	hsa-miR-664	CLIP-seq
MIRT790794	hsa-miR-892b	CLIP-seq
MIRT2476999	hsa-miR-942	CLIP-seq
MIRT790742	hsa-miR-4422	CLIP-seq
MIRT790762	hsa-miR-4719	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
CTCF	Activation	11706010;9407128
CTCF	Repression	11706010
ETS2	Unknown	12890557
HDAC9	Unknown	20145244
JUN	Unknown	8015372
NFIL3	Unknown	22947103
SP1	Activation	15673661
SP1	Unknown	8015372
STAT1	Unknown	9841227
TBP	Unknown	8015372
TFAP2A	Unknown	17651731

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IGI	21803450
GO:0001664	Function	G protein-coupled receptor binding	IPI	11316806
GO:0001774	Process	Microglial cell activation	IDA	18723082
GO:0001774	Process	Microglial cell activation	IGI	15457210, 22406537
GO:0001878	Process	Response to yeast	IMP	20209079
GO:0002265	Process	Astrocyte activation involved in immune response	IGI	23152628
GO:0003677	Function	DNA binding	ISS
GO:0003682	Function	Chromatin binding	IGI	19057576
GO:0004867	Function	Serine-type endopeptidase inhibitor activity	IDA	10652580
GO:0004867	Function	Serine-type endopeptidase inhibitor activity	IEA
GO:0005102	Function	Signaling receptor binding	IBA
GO:0005102	Function	Signaling receptor binding	IPI	19849849, 23921129, 29518356
GO:0005109	Function	Frizzled binding	IPI	18234671
GO:0005158	Function	Insulin receptor binding	IPI	19406747
GO:0005178	Function	Integrin binding	IDA	21126803
GO:0005515	Function	Protein binding	IPI	2119582, 8626687, 8855266, 8887653, 9223340, 9338779, 9461550, 9774383, 10049767, 10081969, 10673326, 10677483, 10681545, 11083918, 11238726, 11278849, 11297421, 11350084, 11724784, 11756426, 11877420, 12054541, 12878203, 12901838, 14527950, 14557245, 14983046, 15615705, 15896298, 15
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	HDA	16502470
GO:0005615	Component	Extracellular space	IDA	29518356
GO:0005615	Component	Extracellular space	IDA	20164328, 23921129, 24827165, 26005850
GO:0005615	Component	Extracellular space	IEA
GO:0005615	Component	Extracellular space	IMP	23640054
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	IGI	19057576
GO:0005641	Component	Nuclear envelope lumen	IDA	21989385
GO:0005737	Component	Cytoplasm	IDA	11689470
GO:0005737	Component	Cytoplasm	IDA	18509662, 18723082
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	IGI	19808651
GO:0005737	Component	Cytoplasm	ISS
GO:0005739	Component	Mitochondrion	IDA	23525105
GO:0005743	Component	Mitochondrial inner membrane	TAS
GO:0005764	Component	Lysosome	IDA	21289173, 23152628
GO:0005768	Component	Endosome	IDA	18353773
GO:0005768	Component	Endosome	IEA
GO:0005769	Component	Early endosome	IBA
GO:0005769	Component	Early endosome	IDA	14527950, 26005850
GO:0005769	Component	Early endosome	IEA
GO:0005769	Component	Early endosome	ISS
GO:0005783	Component	Endoplasmic reticulum	IDA	14527950
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0005794	Component	Golgi apparatus	IBA
GO:0005794	Component	Golgi apparatus	IDA	14527950, 20427278
GO:0005794	Component	Golgi apparatus	IEA
GO:0005794	Component	Golgi apparatus	ISS
GO:0005796	Component	Golgi lumen	TAS
GO:0005798	Component	Golgi-associated vesicle	ISS
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	11689470
GO:0005886	Component	Plasma membrane	IDA	12805363, 20164328, 20427278, 28164773, 28855300
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	10806211
GO:0005905	Component	Clathrin-coated pit	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IGI	19057576
GO:0006417	Process	Regulation of translation	ISS
GO:0006878	Process	Intracellular copper ion homeostasis	ISS
GO:0006897	Process	Endocytosis	IEA
GO:0006897	Process	Endocytosis	ISS
GO:0006915	Process	Apoptotic process	IEA
GO:0007155	Process	Cell adhesion	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IDA	11160457
GO:0007186	Process	G protein-coupled receptor signaling pathway	IGI	11160457
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IGI	22500019
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IDA	18723082, 20141570
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IGI	20141570
GO:0007219	Process	Notch signaling pathway	IEA
GO:0007268	Process	Chemical synaptic transmission	IDA	18216187
GO:0007409	Process	Axonogenesis	IBA
GO:0007409	Process	Axonogenesis	ISS
GO:0007417	Process	Central nervous system development	IBA
GO:0007611	Process	Learning or memory	IGI	15457210, 19118188, 19587288, 20164328, 20445063, 21113149, 24012003, 24052308, 26005850
GO:0007611	Process	Learning or memory	IMP	11880515, 15457210
GO:0007612	Process	Learning	IMP	11140684
GO:0007613	Process	Memory	IGI	11140685, 19118188
GO:0007617	Process	Mating behavior	ISS
GO:0007626	Process	Locomotory behavior	ISS
GO:0008088	Process	Axo-dendritic transport	ISS
GO:0008201	Function	Heparin binding	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IDA	22944668
GO:0008306	Process	Associative learning	IGI	19118188
GO:0008344	Process	Adult locomotory behavior	ISS
GO:0008542	Process	Visual learning	ISS
GO:0009897	Component	External side of plasma membrane	IDA	15537891
GO:0009986	Component	Cell surface	IBA
GO:0009986	Component	Cell surface	IDA	7593229, 18353773
GO:0009986	Component	Cell surface	IEA
GO:0009986	Component	Cell surface	NAS	15457210
GO:0010288	Process	Response to lead ion	IEA
GO:0010468	Process	Regulation of gene expression	IGI	21857966, 26200696
GO:0010468	Process	Regulation of gene expression	IMP	29274751
GO:0010604	Process	Positive regulation of macromolecule metabolic process	IEA
GO:0010628	Process	Positive regulation of gene expression	IDA	26006083
GO:0010628	Process	Positive regulation of gene expression	IGI	20037584, 22198949, 23164821, 27853422, 28008308, 29061364
GO:0010628	Process	Positive regulation of gene expression	IMP	15457210, 23164821, 27853422
GO:0010628	Process	Positive regulation of gene expression	TAS	23164821
GO:0010629	Process	Negative regulation of gene expression	IDA	26006083
GO:0010629	Process	Negative regulation of gene expression	IGI	18234671, 22198949, 27853422, 28008308, 29061364
GO:0010629	Process	Negative regulation of gene expression	TAS	20005821, 21803450
GO:0010996	Process	Response to auditory stimulus	IGI	19118188
GO:0014005	Process	Microglia development	IGI	22198949
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	ISS
GO:0016199	Process	Axon midline choice point recognition	ISS
GO:0016322	Process	Neuron remodeling	ISS
GO:0016358	Process	Dendrite development	ISS
GO:0016504	Function	Peptidase activator activity	IEA
GO:0019722	Process	Calcium-mediated signaling	IDA	11160457
GO:0019722	Process	Calcium-mediated signaling	IGI	11160457
GO:0019731	Process	Antibacterial humoral response	IDA	20209079
GO:0019732	Process	Antifungal humoral response	IMP	20209079
GO:0019899	Function	Enzyme binding	IPI	17112471, 24499793
GO:0030111	Process	Regulation of Wnt signaling pathway	IC	21857966
GO:0030198	Process	Extracellular matrix organization	ISS
GO:0030414	Function	Peptidase inhibitor activity	IEA
GO:0030424	Component	Axon	IEA
GO:0030424	Component	Axon	ISS
GO:0030425	Component	Dendrite	IDA	17251419
GO:0030425	Component	Dendrite	IDA	24012003
GO:0030426	Component	Growth cone	IEA
GO:0030546	Function	Signaling receptor activator activity	IBA
GO:0030546	Function	Signaling receptor activator activity	IDA	11316806
GO:0030549	Function	Acetylcholine receptor activator activity	TAS	19118188
GO:0031091	Component	Platelet alpha granule	IEA
GO:0031093	Component	Platelet alpha granule lumen	TAS
GO:0031175	Process	Neuron projection development	ISS
GO:0031175	Process	Neuron projection development	TAS	27853422
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031583	Process	Phospholipase D-activating G protein-coupled receptor signaling pathway	IDA	18723082
GO:0031901	Component	Early endosome membrane	IDA	16174740
GO:0031904	Component	Endosome lumen	TAS	24305806
GO:0032588	Component	Trans-Golgi network membrane	TAS
GO:0032590	Component	Dendrite membrane	IDA	15537891
GO:0032590	Component	Dendrite membrane	TAS	20032460
GO:0032722	Process	Positive regulation of chemokine production	IGI	22406537
GO:0032729	Process	Positive regulation of type II interferon production	IGI	17255335
GO:0032731	Process	Positive regulation of interleukin-1 beta production	IGI	22406537
GO:0032755	Process	Positive regulation of interleukin-6 production	IGI	22406537
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IGI	12808450, 22198949, 22406537, 29061364
GO:0032930	Process	Positive regulation of superoxide anion generation	IGI	11316806
GO:0032991	Component	Protein-containing complex	IDA	9228033
GO:0032991	Component	Protein-containing complex	IPI	18568035
GO:0033130	Function	Acetylcholine receptor binding	IPI	10681545
GO:0034121	Process	Regulation of toll-like receptor signaling pathway	IGI	20037584
GO:0034185	Function	Apolipoprotein binding	IPI	9211985, 22138302
GO:0034361	Component	Very-low-density lipoprotein particle	IPI	9211985
GO:0034362	Component	Low-density lipoprotein particle	IPI	9211985
GO:0034363	Component	Intermediate-density lipoprotein particle	IDA	22138302
GO:0034363	Component	Intermediate-density lipoprotein particle	IPI	9211985
GO:0034364	Component	High-density lipoprotein particle	IDA	22138302
GO:0034364	Component	High-density lipoprotein particle	IPI	9211985
GO:0035235	Process	Ionotropic glutamate receptor signaling pathway	ISS
GO:0040014	Process	Regulation of multicellular organism growth	ISS
GO:0042056	Function	Chemoattractant activity	IGI	11316806
GO:0042157	Process	Lipoprotein metabolic process	IC	9211985
GO:0042802	Function	Identical protein binding	IPI	16193067, 16286452, 16492752, 17116874, 18059284, 18463291, 18483195, 18499799, 18559859, 18805418, 19164538, 19242475, 19264960, 19304802, 19458258, 19549187, 19706468, 19706519, 19754881, 19805234, 19841277, 20133839, 20133875, 20212142, 20308552, 20383142, 20573181, 20818335, 211
GO:0042803	Function	Protein homodimerization activity	IPI	15447668, 18568035, 22179788, 23386614
GO:0042995	Component	Cell projection	IEA
GO:0043005	Component	Neuron projection	IDA	25390368
GO:0043005	Component	Neuron projection	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IDA	27241555
GO:0043065	Process	Positive regulation of apoptotic process	IDA	11689470
GO:0043065	Process	Positive regulation of apoptotic process	IGI	11689470
GO:0043065	Process	Positive regulation of apoptotic process	TAS	22500019
GO:0043197	Component	Dendritic spine	IDA	11988176
GO:0043198	Component	Dendritic shaft	IDA	11988176
GO:0043204	Component	Perikaryon	IEA
GO:0043235	Component	Receptor complex	IDA	23382219
GO:0043395	Function	Heparan sulfate proteoglycan binding	IMP	21289173
GO:0043410	Process	Positive regulation of MAPK cascade	IGI	15190117
GO:0043410	Process	Positive regulation of MAPK cascade	NAS	22500019
GO:0043410	Process	Positive regulation of MAPK cascade	TAS	11404397
GO:0043525	Process	Positive regulation of neuron apoptotic process	IDA	29371969
GO:0043525	Process	Positive regulation of neuron apoptotic process	IGI	23164821
GO:0044297	Component	Cell body	IDA	25390368
GO:0044304	Component	Main axon	IEA
GO:0045087	Process	Innate immune response	IMP	20209079
GO:0045121	Component	Membrane raft	IBA
GO:0045121	Component	Membrane raft	IDA	24499793
GO:0045202	Component	Synapse	IDA	11988176
GO:0045429	Process	Positive regulation of nitric oxide biosynthetic process	IGI	20037584
GO:0045666	Process	Positive regulation of neuron differentiation	IGI	15190117
GO:0045745	Process	Positive regulation of G protein-coupled receptor signaling pathway	IDA	11316806
GO:0045752	Process	Positive regulation of Toll signaling pathway	IGI	20037584
GO:0045821	Process	Positive regulation of glycolytic process	IGI	29061364
GO:0045931	Process	Positive regulation of mitotic cell cycle	ISS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IGI	23921129
GO:0046330	Process	Positive regulation of JNK cascade	IGI	23921129
GO:0046872	Function	Metal ion binding	IEA
GO:0046875	Function	Ephrin receptor binding	IPI	21113149
GO:0046914	Function	Transition metal ion binding	IEA
GO:0046982	Function	Protein heterodimerization activity	IPI	18568035, 19660551
GO:0048018	Function	Receptor ligand activity	IDA	16174740, 29518356
GO:0048143	Process	Astrocyte activation	IDA	18723082
GO:0048143	Process	Astrocyte activation	IGI	15457210, 20445063
GO:0048169	Process	Regulation of long-term neuronal synaptic plasticity	IGI	23921129
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	20427278
GO:0048669	Process	Collateral sprouting in absence of injury	ISS
GO:0050729	Process	Positive regulation of inflammatory response	IMP	29961672
GO:0050750	Function	Low-density lipoprotein particle receptor binding	ISS
GO:0050786	Function	RAGE receptor binding	IPI	22406537
GO:0050803	Process	Regulation of synapse structure or activity	ISS
GO:0050808	Process	Synapse organization	IGI	19587288, 24012003
GO:0050829	Process	Defense response to Gram-negative bacterium	IDA	20209079
GO:0050830	Process	Defense response to Gram-positive bacterium	IDA	20209079
GO:0050850	Process	Positive regulation of calcium-mediated signaling	IGI	22500019
GO:0050867	Process	Positive regulation of cell activation	NAS	11689470
GO:0050890	Process	Cognition	ISS
GO:0050918	Process	Positive chemotaxis	IEA
GO:0051044	Process	Positive regulation of membrane protein ectodomain proteolysis	IDA	25015123
GO:0051044	Process	Positive regulation of membrane protein ectodomain proteolysis	IGI	25015123
GO:0051087	Function	Protein-folding chaperone binding	IPI	9228033, 23106396
GO:0051246	Process	Regulation of protein metabolic process	IEA
GO:0051247	Process	Positive regulation of protein metabolic process	IEA
GO:0051247	Process	Positive regulation of protein metabolic process	IMP	11404397
GO:0051247	Process	Positive regulation of protein metabolic process	ISS
GO:0051247	Process	Positive regulation of protein metabolic process	TAS	20005821
GO:0051260	Process	Protein homooligomerization	IPI	15447668, 18602473, 22179788, 23386614
GO:0051262	Process	Protein tetramerization	IMP	19660551
GO:0051262	Process	Protein tetramerization	IPI	19660551
GO:0051425	Function	PTB domain binding	IPI	12805363
GO:0051580	Process	Regulation of neurotransmitter uptake	IGI	19118188
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	NAS	22500019
GO:0055037	Component	Recycling endosome	ISS
GO:0055096	Process	Low-density lipoprotein particle mediated signaling	IDA	26005850
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IMP	20209079
GO:0070062	Component	Extracellular exosome	HDA	19199708
GO:0070206	Process	Protein trimerization	IMP	19660551
GO:0070206	Process	Protein trimerization	IPI	19660551
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IDA	18723082, 20141570
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IGI	15457210, 20141570
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	ISS
GO:0070381	Component	Endosome to plasma membrane transport vesicle	IDA	26005850
GO:0070555	Process	Response to interleukin-1	IEA
GO:0070555	Process	Response to interleukin-1	ISS
GO:0070851	Function	Growth factor receptor binding	IEA
GO:0071280	Process	Cellular response to copper ion	IEA
GO:0071287	Process	Cellular response to manganese ion	IEA
GO:0071320	Process	Cellular response to cAMP	IEA
GO:0071874	Process	Cellular response to norepinephrine stimulus	IEA
GO:0090026	Process	Positive regulation of monocyte chemotaxis	IDA	11160457
GO:0090026	Process	Positive regulation of monocyte chemotaxis	IGI	11160457
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IDA	18234671
GO:0097060	Component	Synaptic membrane	IDA	17308309
GO:0097449	Component	Astrocyte projection	IEA
GO:0097645	Function	Amylin binding	TAS	22500019
GO:0098793	Component	Presynapse	IDA	25390368
GO:0098794	Component	Postsynapse	IDA	25390368
GO:0098815	Process	Modulation of excitatory postsynaptic potential	IGI	19118188, 20974225
GO:0098989	Process	NMDA selective glutamate receptor signaling pathway	TAS	17360908
GO:0098992	Component	Neuronal dense core vesicle	IEA
GO:0106003	Component	Amyloid-beta complex	IDA	33239400
GO:0106003	Component	Amyloid-beta complex	IMP	23640054
GO:0106003	Component	Amyloid-beta complex	IPI	22179788, 23386614
GO:0106003	Component	Amyloid-beta complex	TAS	22500019
GO:0120283	Function	Protein serine/threonine kinase binding	IPI	24305806
GO:0140677	Function	Molecular function activator activity	IEA
GO:0141137	Process	Positive regulation of gene expression, epigenetic	IGI	19057576
GO:0141163	Process	Positive regulation of cAMP/PKA signal transduction	IDA	22500019
GO:0150003	Process	Regulation of spontaneous synaptic transmission	IGI	15457210
GO:1900181	Process	Negative regulation of protein localization to nucleus	IGI	18234671
GO:1900221	Process	Regulation of amyloid-beta clearance	IMP	19057576
GO:1900272	Process	Negative regulation of long-term synaptic potentiation	IGI	15457210, 16636059, 19118188
GO:1900273	Process	Positive regulation of long-term synaptic potentiation	IGI	19118188, 20974225
GO:1901224	Process	Positive regulation of non-canonical NF-kappaB signal transduction	IDA	22406537
GO:1901224	Process	Positive regulation of non-canonical NF-kappaB signal transduction	IGI	15457210
GO:1901224	Process	Positive regulation of non-canonical NF-kappaB signal transduction	IMP	29961672
GO:1902514	Process	Regulation of calcium ion transmembrane transport via high voltage-gated calcium channel	IDA	21883149
GO:1902894	Process	Negative regulation of miRNA transcription	IDA	24827165, 25152461
GO:1902950	Process	Regulation of dendritic spine maintenance	IGI	23921129
GO:1902993	Process	Positive regulation of amyloid precursor protein catabolic process	IGI	22406537
GO:1903381	Process	Regulation of endoplasmic reticulum stress-induced neuron intrinsic apoptotic signaling pathway	IGI	23921129
GO:1903523	Process	Negative regulation of blood circulation	IGI	12808450
GO:1904022	Process	Positive regulation of G protein-coupled receptor internalization	IDA	18723082
GO:1904399	Function	Heparan sulfate binding	TAS	21289173
GO:1904472	Process	Positive regulation of endothelin production	IGI	12808450
GO:1904591	Process	Positive regulation of protein import	IDA	23164821
GO:1904646	Process	Cellular response to amyloid-beta	IDA	23459077, 29518356
GO:1904646	Process	Cellular response to amyloid-beta	IDA	29518356
GO:1904646	Process	Cellular response to amyloid-beta	IGI	23152628, 23921129
GO:1905606	Process	Regulation of presynapse assembly	IDA	19726636
GO:1905606	Process	Regulation of presynapse assembly	IMP	19726636
GO:1905898	Process	Positive regulation of response to endoplasmic reticulum stress	IDA	21803450
GO:1905906	Process	Regulation of amyloid fibril formation	IGI	11140685
GO:1905908	Process	Positive regulation of amyloid fibril formation	IMP	19660551
GO:1905945	Process	Regulation of response to calcium ion	ISS
GO:1990000	Process	Amyloid fibril formation	EXP	9737846, 26138908
GO:1990000	Process	Amyloid fibril formation	IMP	25620700
GO:1990090	Process	Cellular response to nerve growth factor stimulus	IEA
GO:1990535	Process	Neuron projection maintenance	IGI	20445063
GO:1990761	Component	Growth cone lamellipodium	IEA
GO:1990777	Component	Lipoprotein particle	IDA	22138302
GO:1990812	Component	Growth cone filopodium	IEA
GO:2000406	Process	Positive regulation of T cell migration	IMP	19660551
GO:2000463	Process	Positive regulation of excitatory postsynaptic potential	IGI	19118188
GO:2001238	Process	Positive regulation of extrinsic apoptotic signaling pathway	IGI	20037584

Other IDs

• MIM: 104760
• HGNC: 620
• e!Ensembl: ENSG00000142192

Protein

• UniProt ID: P05067
• Protein name: Amyloid-beta precursor protein (APP) (ABPP) (APPI) (Alzheimer disease amyloid A4 protein homolog) (Alzheimer disease amyloid protein) (Amyloid precursor protein) (Amyloid-beta (A4) precursor protein) (Amyloid-beta A4 protein) (Cerebral vascular amyloid pe
• Protein function: Functions as a cell surface receptor and performs physiological functions on the surface of neurons relevant to neurite growth, neuronal adhesion and axonogenesis. Interaction between APP molecules on neighboring cells promotes synaptogenesis (P
• PDB: 1AAP, 1AMB, 1AMC, 1AML, 1BA4, 1BA6, 1BJB, 1BJC, 1BRC, 1CA0, 1HZ3, 1IYT, 1MWP, 1OWT, 1QCM, 1QWP, 1QXC, 1QYT, 1TAW, 1TKN, 1X11, 1Z0Q, 1ZE7, 1ZE9, 1ZJD, 2BEG, 2BP4, 2FJZ, 2FK1, 2FK2, 2FK3, 2FKL, 2FMA, 2G47, 2IPU, 2LFM, 2LLM, 2LMN, 2LMO, 2LMP, 2LMQ, 2LNQ, 2LOH, 2LP1, 2LZ3, 2LZ4, 2M4J, 2M9R, 2M9S, 2MGT, 2MJ1
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02177	APP_N	31 → 131	Amyloid A4 N-terminal heparin-binding	Domain
  PF12924	APP_Cu_bd	132 → 188	Copper-binding of amyloid precursor, CuBD	Domain
  PF00014	Kunitz_BPTI	290 → 342	Kunitz/Bovine pancreatic trypsin inhibitor domain	Domain
  PF12925	APP_E2	366 → 548	E2 domain of amyloid precursor protein	Domain
  PF03494	Beta-APP	675 → 713	Beta-amyloid peptide (beta-APP)	Family
  PF10515	APP_amyloid	716 → 766	Beta-amyloid precursor protein C-terminus	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in the brain and in cerebrospinal fluid (at protein level) (PubMed:2649245). Expressed in all fetal tissues examined with highest levels in brain, kidney, heart and spleen. Weak expression in liver. In adult brain, highest ex
• Sequence:

  MLPGLALLLLAAWTARALEVPTDGNAGLLAEPQIAMFCGRLNMHMNVQNGKWDSDPSGTK
  TCIDTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVG
  EFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFR
  GVEFVCCPLAEESDNVDSADAEEDDSDVWWGGADTDYADGSEDKVVEVAEEEEVAEVEEE
  EADDDEDDEDGDEVEEEAEEPYEEATERTTSIATTTTTTTESVEEVVREVCSEQAETGPC
  RAMISRWYFDVTEGKCAPFFYGGCGGNRNNFDTEEYCMAVCGSAMSQSLLKTTQEPLARD
  PVKLPTTAASTPDAVDKYLETPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQA
  KNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITAL
  QAVPPRPRHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYER
  MNQSLSLLYNVPAVAEEIQDEVDELLQKEQNYSDDVLANMISEPRISYGNDALMPSLTET
  KTTVELLPVNGEFSLDDLQPWHSFGADSVPANTENEVEPVDARPAADRGLTTRPGSGLTN
  IKTEEISEVKMDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITL
  VMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN

• Sequence length: 770

Pathways

KEGG:

Serotonergic synapse
Alzheimer disease
Pathways of neurodegeneration - multiple diseases

Reactome:

Platelet degranulation
ECM proteoglycans
Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
G alpha (q) signalling events
G alpha (i) signalling events
Lysosome Vesicle Biogenesis
Formyl peptide receptors bind formyl peptides and many other ligands
TAK1 activates NFkB by phosphorylation and activation of IKKs complex
The NLRP3 inflammasome
Advanced glycosylation endproduct receptor signaling
Deregulated CDK5 triggers multiple neurodegenerative pathways in Alzheimer's disease models
Post-translational protein phosphorylation
TRAF6 mediated NF-kB activation
Insertion of tail-anchored proteins into the endoplasmic reticulum membrane
Purinergic signaling in leishmaniasis infection
Amyloid fiber formation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
ABeta amyloidosis, Arctic type	Pathogenic	rs63751039	RCV000019726	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
ABeta amyloidosis, dutch type	Pathogenic	rs63750579	RCV000019713	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
ABeta amyloidosis, Iowa type	Pathogenic	rs63749810	RCV000019729	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
ABeta amyloidosis, Italian type	Pathogenic	rs63750579	RCV000019727	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
ABetaA21G amyloidosis	Pathogenic	rs63750671	RCV000019717	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Alzheimer disease	Pathogenic; Likely pathogenic	rs63750851, rs2146237965, rs63750399, rs63750579, rs63750264, rs63750671, rs281865161, rs63750066, rs63750734, rs63751039, rs63750973, rs63749810, rs63750643, rs193922916	RCV003509495 RCV001947096 RCV005101409 RCV001386879 RCV000020308 RCV000815476 RCV000020306 RCV000034924 RCV000547582 RCV003509483 RCV000020307 RCV005089281 RCV000687111 RCV002513124 RCV000019734	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Alzheimer disease type 1	Likely pathogenic; Pathogenic	rs2146237857, rs199820754, rs63750264, rs63749964, rs63750671, rs281865161, rs63750066, rs63750399, rs63750734, rs63751039, rs63750973, rs63750643	RCV001842233 RCV003397222 RCV000019714 RCV000019715 RCV000019716 RCV000019718 RCV000019720 RCV000019721 RCV000019723 RCV000019724 RCV000019725 RCV000019728 RCV000019730 RCV000019733	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
APP-related disorder	Pathogenic	rs63750868, rs281865161	RCV004745184 RCV003390694	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Cerebral amyloid angiopathy, APP-related	Likely pathogenic; Pathogenic	rs199820754, rs63750579, rs63750264, rs63750066, rs63749810, rs63750921	RCV003397222 RCV002272024 RCV002496421 RCV002272025 RCV005416108 RCV003987327	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
CEREBRAL AMYLOID ANGIOPATHY, APP-RELATED, PIEDMONT VARIANT	Likely pathogenic	rs63750921	RCV000019731	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Primary degenerative dementia of the Alzheimer type, presenile onset	Likely pathogenic	rs63750066	RCV000826088	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ABETAL34V AMYLOIDOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ALZHEIMER DISEASE, FAMILIAL, 1	—	Disgenet, HPO Disgenet, HPO	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Alzheimer disease, protection against	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ALZHEIMERS DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMNESIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMNESTIC DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMYLOID ANGIOPATHY	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMYLOID NEUROPATHIES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMYLOIDOSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMYLOIDOSIS, CEREBROARTERIAL, APP-RELATED	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANXIETY DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
APP POLYMORPHISM	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHIES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBRAL AMYLOID ANGIOPATHY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBRAL AMYLOID ANGIOPATHY, APP-RELATED, ARCTIC VARIANT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBRAL AMYLOID ANGIOPATHY, APP-RELATED, FLEMISH VARIANT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBRAL AMYLOID ANGIOPATHY, APP-RELATED, IOWA VARIANT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBRAL AMYLOID ANGIOPATHY, APP-RELATED, ITALIAN VARIANT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBRAL AMYLOID ANGIOPATHY, GENETIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBRAL AMYLOID ANGIOPATHY, HEREDITARY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBRAL HEMORRHAGE WITH AMYLOIDOSIS, HEREDITARY, DUTCH TYPE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC LYMPHOCYTIC LEUKEMIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COGNITION DISORDERS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COGNITIVE DYSFUNCTION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEGENERATIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DELIRIUM, DEMENTIA, AMNESTIC, COGNITIVE DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA, VASCULAR	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Early-onset autosomal dominant Alzheimer disease	Uncertain significance; Conflicting classifications of pathogenicity; Likely benign	ClinVar GWAS catalog, Orphanet GWAS catalog, Orphanet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Early-onset dementia of unclear type	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOGENOUS DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EPILEPSY, PARTIAL, WITH VARIABLE FOCI	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EYE MANIFESTATIONS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FAMILIAL ALZHEIMER DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FAMILIAL CEREBRAL AMYLOID ANGIOPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROESOPHAGEAL REFLUX DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hereditary cerebral hemorrhage with amyloidosis	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LATE-ONSET ALZHEIMER'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEARNING DISABILITIES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEARNING DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MEMORY DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NECROSIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEGENERATIVE DISEASES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEGENERATIVE DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPEN-ANGLE GLAUCOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Likely benign; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARALYSIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY CARDIOMYOPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SPLENOMEGALY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Likely benign; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Likely benign; Benign; Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vascular dementia	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
ABeta amyloidosis, Arctic type	Cerebral amyloid angiopathy	Orphanet			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
ABeta amyloidosis, Dutch type	Cerebral amyloid angiopathy	Orphanet			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
ABeta amyloidosis, Iowa type	Cerebral amyloid angiopathy	Orphanet			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
ABeta amyloidosis, Italian type	Cerebral amyloid angiopathy	Orphanet			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
ABetaA21G amyloidosis	Cerebral amyloid angiopathy	Orphanet			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
ABetaL34V amyloidosis	Cerebral amyloid angiopathy	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Acute Confusional Senile Dementia	Senile Dementia	CTD_human_DG	12192006, 12572668, 12746438, 12852432, 1497677, 15590663, 15591071, 15993441, 16204253, 16266835, 16325427, 16492752, 16651627, 1671712, 1678058, 16969627, 17239395, 17430250, 18583042, 19286555, 19818510, 20111991, 20157255, 20640797, 21157020, 21209907, 21980910, 22507317, 23827522, 25352456, 25714973, 27117003, 28448946, 29420472, 30320580		★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	18623069		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	31138460		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	29387243		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	20145244		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	2474201, 28698968, 30509041		★☆☆☆☆ Found in Text Mining only
Adult Learning Disorders	Learning Disorders	CTD_human_DG	16474004, 18533140, 20816828, 22484447, 25213453, 26420483, 27306655, 29729307		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	25204496		★☆☆☆☆ Found in Text Mining only
Age-Related Memory Disorders	Age-Related Memory Disorders	CTD_human_DG	15364477, 18191838, 18599028, 19664757, 19770021, 20816828, 22484447, 23827522, 24858312, 25213453, 25881725, 26420483, 26480858, 27306655, 28448946, 29729307		★☆☆☆☆ Found in Text Mining only
Albinism Oculocutaneous	Oculocutaneous albinism	Pubtator	21408230	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	10037734, 10079962, 10097173, 10098849, 10205007, 10220456, 10373494, 10389030, 10461887, 10599054, 10631141, 10677483, 10734132, 10861242, 10880397, 10931940, 10934205, 10987824, 10997338, 11004129, 11010978, 11126197, 11278337, 11278849, 11309494, 11389157, 11438574, 11461976, 11463349, 11463618, 11500807, 11528419, 11580253, 11606623, 11722581, 11724784, 11849775, 11927634, 12016211, 12016588, 12023906, 12050157, 12058030, 12065626, 12107175, 12153480, 12163376, 12169205, 12197886, 12358789, 12388551, 12408229, 12423364, 12475184, 12480937, 12506199, 12507914, 12563035, 12581205, 12645527, 12665519, 12684519, 12716908, 12780348, 12787077, 12801932, 12801934, 12805363, 12807963, 12857759, 12860412, 12865947, 12893827, 12900421, 12917434, 1386714, 14504402, 14511378, 14525989, 14557249, 14752113, 14754886, 14970211, 14970212, 14978286, 14997933, 15197182, 15201367, 15210705, 15234980, 15251450, 15255950, 15286082, 15341515, 15485850, 15492223, 15522881, 15548496, 15584903, 15615705, 15615712, 15632190, 15659232, 15695586, 15699037, 15737955, 15767460, 15778502, 15814793, 15824110, 15882940, 15890777, 15937275, 15964569, 15967987, 15975076, 15983050, 16014629, 16027166, 16079141, 16109164, 16199521, 16199552, 16201761, 16293696, 16303768, 16305624, 16420488, 1642228, 16543533, 16611980, 16631344, 16685645, 16741936, 16788245, 1679288, 16817891, 16828203, 16943564, 16945610, 16968707, 1702541, 17028131, 17151287, 17157413, 17170108, 17170111, 17188679, 17220890, 17254013, 17301053, 17314098, 17344400, 17353911, 17448150, 17482359, 17545141, 17601350, 17613531, 17626163, 17652175, 17653279, 17849360, 17890228, 17916554, 1791966, 17940047, 17953673, 17959829, 17986607, 18055545, 18234671, 18317569, 18349519, 18373737, 18378046, 1838578, 18401021, 18408165, 18426579, 18431028, 18437002, 18458217, 18468996, 18479822, 18508486, 18509662, 18541914, 18571334, 18585350, 18597778, 18602473, 18657529, 18665237, 18675254, 18768471, 18813964, 19015532, 19019493, 19038266, 19141082, 19153374, 19162185, 19169965, 19183255, 19196432, 19204155, 19221430, 19262954, 19264960, 19286555, 19295912, 19302194, 19326964, 19328595, 19346482, 19350381, 19363254, 19385666, 19438816, 19450545, 19457079, 19478559, 19496804, 19524115, 19541930, 19542221, 19558452, 19571732, 19694428, 19722699, 19726677, 19759000, 19759550, 19776335, 19812466, 19892322, 19896952, 19897485, 19901993, 19906985, 19923550, 20016085, 20021390, 20049720, 20061629, 20080541, 20106965, 20110602, 20139073, 20145244, 20186853, 20217101, 20228223, 20230749, 20348104, 20354142, 20405578, 20414590, 20419305, 20437581, 20452985, 20463975, 20464283, 20477946, 20502642, 20561382, 20567859, 20576610, 20593467, 20606367, 20634593, 20679343, 20683212, 20697031, 20796026, 20802215, 20817151, 20828565, 20860566, 20890432, 20923778, 20927385, 21034535, 21071869, 21094210, 21167219, 21184792, 21185309, 21193246, 21196064, 21209907, 21228296, 21267410, 21272192, 21280075, 21280088, 21293490, 21297258, 21297948, 21298039, 21315759, 21329555, 21357415, 21357834, 21364883, 21372823, 21382638, 21388376, 21398043, 21408230, 21415543, 21440556, 21455839, 21464208, 21464905, 21500352, 21513285, 21565831, 21574595, 21606494, 21616081, 21629967, 21640828, 21652708, 21654062, 21654203, 21658330, 21668291, 21699541, 21712440, 21715329, 21718295, 21797254, 21821948, 21832091, 21841246, 21841249, 21868378, 21949245, 21949792, 21958962, 21971401, 21983012, 22074738, 22077634, 22084929, 22101948, 22162065, 22166940, 22174920, 22180352, 22184106, 22216291, 22232349, 22242635, 22258516, 22267728, 22297646, 22303960, 22307680, 22351782, 22385841, 22388478, 22390463, 22461629, 22477259, 22479317, 22489754, 22491860, 22500019, 22508715, 22514144, 22547976, 22551351, 22551728, 22558227, 22580042, 22621900, 22622826, 22637583, 22640423, 22654059, 22670059, 22685292, 22695614, 22702962, 22773458, 22778868, 22778873, 22784036, 22805771, 22855860, 22867901, 22873724, 22879596, 22879628, 22888099, 22898493, 22906069, 22911797, 22952038, 22952813, 22965806, 22968369, 22970285, 22976236, 22996644, 23022416, 23025824, 23037886, 23053546, 23070047, 23085935, 23095849, 23100439, 23102120, 23133543, 23134284, 23134465, 23137949, 23167255, 23173071, 23186391, 23186989, 23203093, 23224319, 23237322, 23237523, 23269595, 23330981, 23358601, 23359572, 23415897, 23419831, 23421682, 23430745, 23434393, 23474040, 23479184, 23505467, 23509981, 23530929, 23541187, 23546882, 23553344, 23562540, 23635404, 23652625, 23693133, 23762479, 23779114, 23805218, 23864927, 23865807, 23884042, 23894546, 23902769, 23919771, 23924802, 23965993, 23990795, 24000923, 24011543, 24014820, 24026422, 24028142, 24041422, 24048412, 24063855, 24067654, 24112793, 24140124, 24140343, 24145446, 24164736, 24186361, 24244308, 24252272, 24265728, 24278306, 24308007, 24333289, 24346217, 24348898, 24363250, 24373285, 24378418, 24448790, 24468113, 24469457, 24475133, 24498434, 24524897, 24529499, 24597507, 24714650, 24733378, 24735980, 24756381, 24773620, 24812571, 24818077, 24848988, 24859793, 24874077, 24880964, 24902845, 24905226, 24919190, 24931469, 24936411, 24941200, 24948815, 24949887, 24952994, 24955499, 24972054, 24995708, 25022335, 25040401, 25053581, 25079797, 25088003, 25089527, 25207541, 25207746, 25275648, 25288138, 25300967, 25336154, 25352592, 25359283, 25365775, 25382023, 25382225, 25395337, 25410733, 25452160, 25456845, 25528641, 25531812, 25531836, 25561733, 25591988, 25614623, 25623662, 25650802, 25650940, 25655625, 25678559, 25688081, 25695604, 25707004, 25723573, 25732182, 25733893, 25739352, 25743013, 25808939, 25862550, 25889972, 25943889, 25948718, 25951880, 25961951, 26004017, 26010513, 26045787, 26054501, 26068894, 26079411, 26086184, 26101858, 26103884, 26119087, 26121081, 26154755, 26170148, 26180595, 26190022, 26198711, 26208959, 26216398, 26231074, 26239177, 26244608, 26246491, 26261684, 26263968, 26293308, 26302353, 26332787, 26402107, 26402409, 26402623, 26409164, 26416646, 26421299, 26430784, 26448035, 26453205, 26542804, 26564777, 26635473, 26656159, 26754172, 26756745, 26758487, 26803359, 26809345, 26813969, 26827680, 26842741, 26898943, 26924205, 26924229, 26936520, 26983928, 26988102, 27016065, 27029347, 27036079, 27036121, 27036949, 27072891, 27079717, 27079723, 27084229, 27085491, 27099354, 27104649, 27155979, 27167300, 27177090, 27207326, 27212113, 27248362, 27249223, 27252381, 27258307, 27302062, 27334799, 27347598, 27352802, 27356100, 27358067, 27379525, 27383650, 27392867, 27402826, 27414264, 27469165, 27473843, 27486134, 27521081, 27522594, 27532054, 27532339, 27563067, 27589530, 27605218, 27622770, 27629394, 27641902, 27650968, 27653981, 27662285, 27662287, 27701409, 27718298, 27748454, 27776263, 27785004, 27789410, 27832767, 27834776, 2783775, 27841000, 27884212, 27901073, 27997711, 28025335, 28025562, 28031462, 28049728, 28052060, 28196768, 28209190, 28245546, 28247064, 28250274, 28267202, 28285880, 28291226, 28296235, 28319241, 28349199, 28349921, 28350801, 28359293, 28362827, 28392295, 28413178, 28428554, 28435985, 28557010, 28584111, 28587659, 28611418, 28637867, 28671113, 28684415, 28704393, 28710429, 28731438, 28731444, 28745649, 28777752, 28790170, 28818092, 28842697, 28852095, 28855400, 28855598, 28879083, 28893185, 28919235, 2896589, 28984607, 29027727, 29036821, 29037261, 29046353, 29054928, 29061195, 29078389, 29087319, 29109429, 29120328, 29155708, 29156377, 29175279, 29182052, 29274321, 29330303, 29331531, 29349888, 29356823, 29374229, 29374250, 29387532, 29394903, 29397305, 29439331, 29458036, 29474672, 29476081, 29485701, 29487944, 29512286, 29527500, 29530923, 29559004, 29592889, 29618714, 29687857, 29700597, 29710718, 2973063, 29807259, 29859129, 29860944, 29886525, 29895690, 29899186, 29934873, 29945658, 29959224, 29961672, 29967939, 30021643, 30032260, 30037983, 30038319, 30040735, 30103547, 30108157, 30120254, 30120299, 30120417, 30134963, 30143535, 30149449, 30180184, 30192871, 30257187, 30318785, 30355438, 30359879, 30371777, 30374196, 30375373, 30382187, 30390679, 30445590, 30470799, 30497535, 30504224, 30547775, 30549411, 30557391, 30559478, 30563962, 30569084, 30572643, 30576228, 30579367, 30596401, 30611996, 30634129, 30635491, 30664241, 30694418, 30704480, 30704603, 30716424, 30717814, 30734106, 30755484, 30763379, 30765195, 30783169, 30804528, 30821607, 30851551, 30856114, 30883351, 30893872, 30899092, 30904577, 30914454, 30914681, 30917570, 30922415, 30949973, 30980041, 31004935, 31097588, 31127775, 31159590, 31165862, 31182772, 31195602, 31208071, 31250578, 31256117, 31263161, 31270305, 31281568, 31350392, 31353852, 31370031, 31391004, 3140239, 31456032, 31500627, 31511058, 31536662, 31557888, 31571352, 31580390, 31600059, 31601267, 31604820, 31609694, 31611872, 31627126, 31627825, 31628215, 31634898, 31664019, 31684105, 31733655, 31745181, 31762188, 31771069, 31779670, 31794135, 31796668, 31805990, 31810489, 31848379, 31862015, 31884473, 31884486, 31888732, 31931428, 31953468, 31958088, 31959733, 31991575, 31996371, 32011129, 32035419, 32039841, 32039845, 32046006, 32054832, 32057937, 32067693, 32072450, 32091549, 32133800, 32142100, 32156251, 32164763, 32170138, 32192521, 32199223, 32216003, 32272787, 32300132, 32301581, 32366888, 32376688, 32388561, 32460813, 32469899, 32498476, 32517787, 32531337, 32545801, 32566665, 32568193, 32568358, 32580499, 32581318, 32582986, 32589876, 32591471, 32603776, 32630447, 32630528, 32641719, 32649026, 32678846, 32722745, 32737755, 32741818, 32749525, 32751526, 32759192, 32787955, 32817639, 32846925, 32854315, 32878879, 32885413, 32911327, 32917274, 32919460, 32920622, 32967721, 33003328, 33006056, 33010136, 33014268, 33023779, 33024077, 33030915, 33044487, 33063327, 33093220, 33119615, 33120085, 33129344, 33129364, 33139554, 33167440, 33188256, 33213489, 33213512, 33215319, 33217338, 33228083, 33237748, 33239403, 33246059, 33267804, 33282112, 33293506, 33303945, 33314757, 33331917, 33336223, 33370284, 33374505, 33408147, 33408150, 33420184, 33439987, 33449094, 33451357, 33461764, 33475074, 33488947, 33514647, 33521872, 33522967, 33536237, 33571524, 33580208, 33597025, 33609158, 33646147, 33652304, 33694209, 33720890, 33788575, 33809978, 33813555, 33832546, 33839158, 33848613, 33892504, 33895633, 33912975, 33934115, 33983116, 34002480, 34018654, 34035398, 34050864, 34057078, 34088002, 34092785, 34102969, 34108509, 34153352, 34153464, 34164834, 34171228, 34180956, 34193504, 34209175, 34209408, 34252282, 34252876, 34252884, 34254442, 34280181, 34318994, 34319632, 34324289, 34342183, 34366346, 34427746, 34450034, 34459862, 34462463, 34469142, 34469849, 34481077, 34488882, 34521342, 34581957, 34585226, 34602080, 34615922, 34618331, 34657885, 34663629, 34680174, 34681938, 34685681, 34724333, 34728605, 34732252, 34749609, 34763720, 34767070, 34768981, 34769426, 34775974, 34778460, 34784296, 34806611, 34830060, 34831318, 34842295, 34878807, 34887476, 34918018, 34920091, 34944462, 34944492, 34961556, 34964690, 34966443, 34977242, 34981115, 34987110, 35008544, 35008592, 35041991, 35056363, 35065037, 35087179, 35109872, 35133877, 35150241, 35197498, 35209952, 35212149, 35213141, 35229272, 35241726, 35246267, 35248531, 35276041, 35304289, 35328387, 35354048, 35365805, 35380901, 35383826, 35528169, 35570488, 35575522, 35619174, 35628325, 35641311, 35643314, 35659599, 35666749, 35667615, 35697992, 35698260, 35731195, 35738259, 35778717, 35811524, 35831715, 35850649, 35851379, 35862308, 35876740, 35883623, 35887031, 35887339, 35895133, 35901928, 35925685, 35932032, 35943292, 35962130, 35964194, 35976328, 36001141, 36008818, 36026506, 36039594, 36040555, 36042609, 36067305, 36096822, 36102248, 36108600, 36120786, 36142143, 36142742, 36150020, 36153390, 36160711, 36173882, 36217304, 36224601, 36246562, 36271678, 36281062, 36281662, 36281668, 36284363, 36302506, 36329114, 36384809, 36400770, 36411364, 36444490, 36448495, 36544231, 36555832, 36586468, 36609403, 36626935, 36632701, 36633448, 36697254, 36706152, 36719634, 36734539, 36737481, 36745413, 36745855, 36776057, 36788318, 36800984, 36847012, 36901741, 37002186, 37016464, 37017737, 37047608, 37047617, 37062307, 37085326, 37108607, 37110558, 37113066, 37120095, 37142132, 37149819, 37188537, 37208174, 37239970, 37247383, 37259128, 37272536, 37274074, 37290814, 37356183, 37433038, 37454217, 37511008, 37550416, 37587672, 37608325, 37629148, 37726569, 37735227, 37762325, 37788276, 37801139, 37834082, 37853914, 37875471, 37899059, 37918868, 37923721, 37959001, 38002954, 38007657, 38036535, 38037144, 38148047, 38157874, 38160357, 38167548, 38176923, 38178159, 38203287, 38233149, 38302480, 38362804, 38427476, 38436541, 38528318, 38548482, 38554950, 39186798, 39187705, 39197213, 39210294, 39273614, 39322953, 39380021, 39385222, 39394180, 39426463, 39497301, 39518952, 39613049, 39632332, 39670385, 39684582, 39684731, 39684928, 39752902, 39875235, 39940945, 39962560, 40016812, 40037473, 40044591, 40050704, 40057456, 40057942, 40088886, 40118053, 40121165, 40122980, 40149496, 40164724, 40174910, 40205199, 40243521, 40244244, 40275379, 40334312, 40334744, 40354780, 40363838, 40419521, 40465637, 40494737, 40498820, 40528303, 40545561, 40551292, 40594040, 40595720, 40616179, 40619807, 7534068, 7568089, 7575468, 7592834, 7619525, 7686976, 7695913, 7724603, 7761987, 7830934, 7867760, 7957938, 7961704, 7991571, 8018913, 8021287, 8034590, 8040342, 8063812, 8077213, 8078890, 8154870, 8181478, 8240235, 8313898, 8344949, 8352272, 8415756, 8576122, 8610157, 8626795, 8644866, 8665854, 8670881, 8863158, 8887653, 8938268, 8952519, 8955133, 8955370, 9048759, 9048763, 9048765, 9065490, 9108049, 9218507, 9236226, 9250173, 9256259, 9258892, 9275228, 9292885, 9326287, 9375682, 9395288, 9398632, 9422365, 9461605, 9466562, 9478949, 9497354, 9546349, 9576554, 9593752, 9614075, 9630681, 9639678, 9668120, 9693105, 9729270, 9748217, 9780232, 9811326, 9837937, 9844014, 9861015	Associate	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Alzheimer Disease	Alzheimer disease	Pubtator	10409650, 12048239, 12135764, 14559775, 15509549, 16508101, 16524370, 16608822, 16763046, 17158800, 17332749, 17346237, 17620492, 17675576, 18234110, 19087254, 19707560, 19725829, 20236612, 20452985, 20463402, 20628413, 21047401, 21115843, 21205220, 21681798, 21700583, 21816272, 22214483, 22510327, 22532566, 22673115, 22685292, 22708832, 22981873, 23268705, 23378928, 23685131, 23761040, 23812658, 23907250, 24107601, 24225948, 24352696, 24359497, 24367508, 24376644, 24390130, 24401146, 24413619, 24523906, 24888381, 25053581, 25921538, 26410307, 26473367, 26618502, 26779997, 27176072, 27908343, 27926491, 29141208, 29298722, 29361890, 29402979, 29615132, 29959263, 29980228, 30099334, 30573871, 30736391, 30741722, 30755484, 30902060, 31256132, 31454549, 31671598, 31721455, 31841137, 32301481, 32488024, 32539856, 33002038, 33128835, 33139712, 33398998, 33731436, 33811735, 34034805, 34052751, 34704631, 34924383, 34948396, 35196169, 35203328, 35215394, 35598043, 35960729, 36012298, 36572121, 36588011, 36773106, 36858574, 36929840, 37224508, 37258256, 37331354, 37365240, 37620502, 37884611, 38066066, 38138438, 38528836, 39827005, 40332390, 40399749, 40723827, 7622456, 7761985, 7806491, 7991571, 9173910, 9195901, 9626067	Stimulate	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Alzheimer Disease	Alzheimer disease	Pubtator	11404470, 21116050, 21987546, 22343824, 23093013, 25072319, 26940242, 28455519, 30526652, 32114428, 32911327, 33032662, 33348885, 33370284, 33837271, 34342183, 37173305, 38615405	Inhibit	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Alzheimer disease type 1	Alzheimer disease	Pubtator	22101948, 22491860, 30045758	Associate	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Alzheimer disease type 1	Alzheimer disease	CLINVAR_DG			★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Alzheimer Disease, Early Onset	Alzheimer disease	BEFREE	10026204, 10065997, 10097173, 10559555, 10860781, 10867787, 11444983, 11568920, 11741394, 11848684, 11992262, 12052536, 12433263, 12754354, 12925374, 1302033, 1303172, 1303291, 1365885, 14769392, 15119738, 15601622, 1619445, 16369530, 16921174, 16931535, 17427190, 1791986, 18043715, 18387709, 18403054, 18413473, 18437002, 19073399, 1922963, 19950418, 20080541, 20523046, 21034535, 21424791, 21463452, 21959359, 22001921, 22489754, 24964199, 25138979, 26014970, 26803359, 27120160, 27422356, 27585646, 27838006, 27983553, 28106563, 28738127, 28988799, 29175279, 29740579, 29858078, 29861166, 29945247, 30104866, 30114415, 30231670, 30349052, 30510423, 30760863, 30797548, 31180641, 31381512, 31623876, 7489411, 7724053, 8117426, 8290042, 8361651, 8469399, 8621605, 8649577, 8737975, 9328472		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Early Onset	Alzheimer disease	CTD_human_DG	12192006, 12572668, 12746438, 12852432, 1497677, 15590663, 15591071, 15993441, 16204253, 16266835, 16325427, 16492752, 16651627, 1671712, 1678058, 16969627, 17239395, 17430250, 18583042, 19286555, 19818510, 20111991, 20157255, 20640797, 21157020, 21209907, 21980910, 22507317, 23827522, 25352456, 25714973, 27117003, 28448946, 29420472, 30320580		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Early Onset	Alzheimer disease	CLINVAR_DG	1303275, 15365148, 15488330, 19363265, 23224319, 25948718, 26402770, 26803359, 28350801, 30279455		★☆☆☆☆ Found in Text Mining only
Alzheimer disease, familial, type 3	Alzheimer disease	BEFREE	12885570, 15016076, 17427190, 20951388, 27818272, 28241068, 29081063, 30851551, 31004935, 31034995, 31287605, 8744398		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	10430506, 10672260, 11500807, 11803125, 12016588, 12169205, 15024728, 15714520, 16243604, 17098871, 17427190, 17704509, 17826910, 17949987, 18938222, 19126407, 21424791, 21605030, 22312439, 22393166, 23750206, 24336208, 24473795, 24529499, 26014970, 26239177, 28808293, 30208929, 30231670, 30474860, 30820047, 31289348, 8154870, 8910899, 9111746		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	CTD_human_DG	12192006, 12572668, 12746438, 12852432, 1497677, 15590663, 15591071, 15993441, 16204253, 16266835, 16325427, 16492752, 16651627, 1671712, 1678058, 16969627, 17239395, 17430250, 18583042, 19286555, 19818510, 20111991, 20157255, 20640797, 21157020, 21209907, 21980910, 22507317, 23827522, 25352456, 25714973, 27117003, 28448946, 29420472, 30320580		★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	UNIPROT_DG	10097173, 10631141, 10656250, 10665499, 10677483, 10867787, 11063718, 11311152, 11528419, 12034808, 1302033, 1303239, 1303275, 1415269, 1465129, 15201367, 15365148, 15668448, 1671712, 1678058, 1908231, 1925564, 1944558, 8267572, 8290042, 8476439, 8577393, 8886002, 9328472, 9754958		★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	CLINVAR_DG	11441013, 11978821, 15776278, 1925564, 19281847, 20228223, 21335619, 23649480, 24524897, 24650794, 24878480, 25138979, 26104569, 26402770, 27000221, 27838006, 27858710, 28350801, 7806491, 8810256		★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	CTD_human_DG	12192006, 12572668, 12746438, 12852432, 1497677, 15590663, 15591071, 15993441, 16204253, 16266835, 16325427, 16492752, 16651627, 1671712, 1678058, 16969627, 17239395, 17430250, 18583042, 19286555, 19818510, 20111991, 20157255, 20640797, 21157020, 21209907, 21980910, 22507317, 23827522, 25352456, 25714973, 27117003, 28448946, 29420472, 30320580		★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	HPO_DG			★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease, Focal Onset	Alzheimer disease	CTD_human_DG	12192006, 12572668, 12746438, 12852432, 1497677, 15590663, 15591071, 15993441, 16204253, 16266835, 16325427, 16492752, 16651627, 1671712, 1678058, 16969627, 17239395, 17430250, 18583042, 19286555, 19818510, 20111991, 20157255, 20640797, 21157020, 21209907, 21980910, 22507317, 23827522, 25352456, 25714973, 27117003, 28448946, 29420472, 30320580		★☆☆☆☆ Found in Text Mining only
Amnesia	Amnesia	BEFREE	11773429, 12832546, 17981591, 19181896, 19879019, 21199446, 21771791, 22042871, 27388605, 27457810, 28238167, 28420695, 28662102, 28801921, 29700775, 31321704, 31591753, 31678156, 31757962, 9206974		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amnesia	Amnesia	CTD_human_DG	12642396		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyloid angiopathy	Amyloid angiopathy	Pubtator	16027166, 17448150, 20228223, 23018443, 33278904, 36373322	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyloid Neuropathies Familial	Amyloid neuropathy	Pubtator	20228223, 24028142	Associate	★☆☆☆☆ Found in Text Mining only
Amyloid Neuropathies, Familial	AMYLOID CARDIOMYOPATHY	BEFREE	16552785		★☆☆☆☆ Found in Text Mining only
Amyloid Neuropathies, Familial	AMYLOID CARDIOMYOPATHY	LHGDN	17701472		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	10524281, 10607841, 10636133, 10675649, 10804202, 10818510, 11004129, 11193147, 11684351, 11741394, 11790115, 12086704, 12124431, 12163376, 12427835, 12471021, 12505425, 12824056, 15311281, 15452128, 15703276, 1574806, 15755686, 15768036, 15983050, 16027166, 1627458, 16354928, 16541076, 16709678, 17241160, 17258906, 17712316, 17726461, 18202172, 18322372, 18679696, 19036982, 19093876, 19166938, 19295164, 1968460, 20062056, 20595065, 20630068, 20675367, 20693289, 20937383, 20941644, 20952385, 21059265, 21081501, 21167913, 21177866, 21179415, 21214928, 21239495, 21289607, 21347380, 21688176, 21712440, 21769132, 21880397, 21880910, 21903077, 21948247, 22029666, 22079157, 22122372, 22219198, 22230888, 22321014, 22342341, 22355794, 22514144, 22518836, 22542680, 22700814, 22709416, 22915123, 23133641, 23294492, 23382922, 23401344, 23407662, 23447589, 23495999, 23496965, 23686791, 23742273, 23761903, 23850592, 23905998, 23926267, 23951005, 23951061, 23968591, 24205320, 24223114, 24252272, 24257464, 24289518, 24373285, 24400342, 24517102, 24550686, 24599400, 24644038, 24687915, 24813062, 24833601, 24846616, 24885390, 24966375, 24995708, 25018108, 25027006, 25422493, 25461285, 25583562, 2563163, 2569883, 25747037, 25756590, 25917310, 25939386, 26080426, 26302353, 26332787, 26369878, 26530776, 26566997, 26581893, 26651340, 26783004, 26906357, 26918424, 26919808, 26948379, 27069115, 27163814, 27235807, 27430330, 27563067, 27737765, 27883331, 27894840, 27915995, 27923413, 28004401, 28160136, 28223223, 28332150, 28337142, 28378593, 28420695, 28429406, 28457944, 28469554, 28501482, 28547526, 28556232, 28591569, 28603494, 28612181, 28637503, 28663518, 28701326, 28728464, 28731260, 28737945, 28743126, 28771976, 28885485, 28899417, 28985224, 29018038, 29032190, 29056359, 29078389, 29097202, 29097597, 29158112, 29292421, 29383688, 29386875, 29395359, 29411122, 29420472, 29477284, 29477641, 29487944, 29506560, 29545118, 29614860, 29615128, 29618714, 29634349, 29656360, 29699479, 29700007, 29704008, 29740283, 29758264, 29858247, 29955664, 30001606, 30040730, 30102687, 30128052, 30136058, 30182855, 30207230, 30210292, 30221701, 30232325, 30283032, 30315100, 30320383, 30332887, 30356847, 30377267, 30397132, 30400912, 30445024, 30471405, 30498753, 30542451, 30545942, 30557391, 30563837, 30572184, 30582328, 30605056, 30622228, 30623730, 30639321, 30682043, 30747419, 30823541, 30868446, 30905823, 31016475, 31022450, 31039414, 31089060, 31097468, 31219699, 31231836, 31248209, 31373844, 31379559, 3140239, 31445975, 31536785, 31701556, 31705038, 31727182, 31753135, 31781019, 31791116, 7588622, 8140621, 8744403, 8901624, 8964522		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyloidosis	Amyloidosis	Pubtator	10920030, 11004129, 12408229, 12787077, 18055545, 19189048, 23686534, 26332787, 26448035, 31600059, 39341941	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyloidosis	Amyloidosis	LHGDN	16485107, 16906128, 19218342		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyloidosis	Amyloidosis	CTD_human_DG	23541064		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	LHGDN	15837590, 18843496		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	16856153, 21385376, 22678056, 26600047, 28848086, 29899726, 30291183, 30394813		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	19478559, 30572951, 36952379, 39278909	Associate	★☆☆☆☆ Found in Text Mining only
Amyotrophic lateral sclerosis 1	Amyotrophic lateral sclerosis	Pubtator	36707813	Associate	★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Familial	Amyotrophic lateral sclerosis	BEFREE	11772995, 15538967		★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	18480379		★☆☆☆☆ Found in Text Mining only
Angelman Syndrome	Angelman Syndrome	BEFREE	27327493		★☆☆☆☆ Found in Text Mining only
Angioedema	Angioedema	Pubtator	16175507	Associate	★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	26261495		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	15114629, 19428628, 19664757, 21709248, 22709352, 25349165, 25744714, 27439903, 28358367, 29175809		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	15114629, 19428628, 19664757, 21709248, 22709352, 25349165, 25744714, 27439903, 28358367, 29175809		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anxiety Disorders	Anxiety Disorder	CTD_human_DG	19664757		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anxiety States, Neurotic	Anxiety Disorder	CTD_human_DG	19664757		★☆☆☆☆ Found in Text Mining only
Aphasia	Aphasia	BEFREE	26337232		★☆☆☆☆ Found in Text Mining only
Aphasia	Aphasia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Apnea	Apnea	Pubtator	24439479	Inhibit	★☆☆☆☆ Found in Text Mining only
Apraxias	Apraxia	BEFREE	26337232		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	12065323, 16973241, 19058878, 28148544, 29344304		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	39342401	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	12061423	Inhibit	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	20513247, 31127789		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	29956778	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	10037734, 11016545, 16797788		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	36982288, 38148047	Associate	★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	2136770, 36833366	Associate	★☆☆☆☆ Found in Text Mining only
Ataxia, Spinocerebellar	Spinocerebellar Ataxia	BEFREE	27911893		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	12065323, 16973241, 19058878, 28148544, 29344304		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	36448495, 37541842	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	30772532		★☆☆☆☆ Found in Text Mining only
Atrophy	Atrophy	Pubtator	20802215, 25678559, 25990306, 26843008, 27521573, 30686901, 31370031, 32057937, 33262228, 33548794, 36773106, 37061167	Associate	★☆☆☆☆ Found in Text Mining only
Atrophy	Atrophy	Pubtator	30765195, 31437719, 40174910	Stimulate	★☆☆☆☆ Found in Text Mining only
Attention Deficit and Disruptive Behavior Disorders	Attention deficit hyperactivity disorder	Pubtator	31915189	Stimulate	★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder	Attention Deficit Hyperactivity Disorder	BEFREE	21368062		★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	39173065	Stimulate	★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	21368062		★☆☆☆☆ Found in Text Mining only
Aural Atresia Congenital	Congenital aural atresia	Pubtator	19162185	Associate	★☆☆☆☆ Found in Text Mining only
AURAL ATRESIA, CONGENITAL	Aural Atresia, Congenital	BEFREE	10570203, 11676289, 11816788, 14503015, 15311281, 15876981, 16133541, 16170565, 16369530, 16555084, 16612980, 16783171, 16921174, 16959815, 17963746, 18184371, 19457117, 19468344, 21463452, 21688176, 22137428, 24021653, 25828868, 26248866, 27858710, 28701379, 29195510, 29706885, 29770843, 31278851, 31333665, 31640101, 7482672		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	31024350		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	22085641, 23840007, 25726360, 26398526, 27327493, 28192196, 30862493		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	24252310, 32345355	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	34710239	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Lymphoproliferative Syndrome	Autoimmune lymphoproliferative disorder	Pubtator	11588044	Associate	★☆☆☆☆ Found in Text Mining only
Avellino corneal dystrophy	Avellino Corneal Dystrophy	BEFREE	23056220, 30930125		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	28963051		★☆☆☆☆ Found in Text Mining only
Basal Ganglia Diseases	Basal ganglia disease	Pubtator	15148385	Associate	★☆☆☆☆ Found in Text Mining only
Behavioral variant of frontotemporal dementia	Behavioral Variant Of Frontotemporal Dementia	BEFREE	28592456, 30906945		★☆☆☆☆ Found in Text Mining only
beta Thalassemia	Beta thalassemia	Pubtator	9236226	Associate	★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary atresia	Pubtator	39341941	Associate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	11810290		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bladder Neoplasm	Bladder Neoplasm	BEFREE	30021247		★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood coagulation disorder	Pubtator	36448495	Associate	★☆☆☆☆ Found in Text Mining only
Brain atrophy	Brain atrophy	BEFREE	24885175		★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	31688040, 33303945, 33933117, 7619525	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Edema	Brain edema	Pubtator	35569976	Associate	★☆☆☆☆ Found in Text Mining only
Brain Injuries	Brain injuries	Pubtator	25575135	Associate	★☆☆☆☆ Found in Text Mining only
Brain Injuries Traumatic	Brain injuries	Pubtator	19326964, 28557010, 30250223, 34663629	Associate	★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	BEFREE	11818564, 23519520		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	1531166, 23889773, 25043050, 25491510, 28847292, 30108157, 30470613, 31746365		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	20678196, 23889773, 25043050, 30108157, 31746365, 40178903, 9434630	Associate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	12967475, 15263077		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	12967475	Associate	★☆☆☆☆ Found in Text Mining only
CADASIL Syndrome	CADASIL Syndrome	BEFREE	10818516, 22137428		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	30108157	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	16458426		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	18837082, 27507654, 32133800	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	30021247		★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	17651731, 39741285	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	30394813		★☆☆☆☆ Found in Text Mining only
Carcinoma, Pancreatic Ductal	Pancreatic Ductal Carcinoma	BEFREE	26261495		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	CTD_human_DG	29068127		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathies	Cardiomyopathy	Pubtator	35938548	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathies, Primary	Cardiomyopathy	CTD_human_DG	29068127		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic	Hypertrophic cardiomyopathy	Pubtator	37628806	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	30124449, 31722714		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	35938548	Associate	★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	Pubtator	22984439	Associate	★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	33559929, 33654213	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Amyloid Angiopathy	Cerebral amyloid angiopathy	Pubtator	10800967, 11004129, 11441013, 11580253, 12163376, 12753080, 12754271, 12754344, 15814793, 15975076, 18055545, 18597778, 19061884, 19162185, 19385666, 19770225, 20228223, 20576603, 21267410, 21654062, 22156599, 22778873, 23134465, 24028142, 25828868, 25934480, 26190022, 26988843, 27016065, 27179972, 27543695, 27869301, 27903811, 28349199, 28557134, 29037261, 29770843, 29895690, 29978619, 31664019, 31958088, 32059400, 32164763, 32518112, 32575521, 32631441, 33228083, 33420184, 33503519, 33805778, 33918046, 34599967, 35074002, 35666749, 35778717, 35940900, 36102248, 36448495, 37021572, 37170141, 37603921, 38362804, 39334385, 40334744	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebral Amyloid Angiopathy	Cerebral amyloid angiopathy	BEFREE	10911965, 10912918, 11021833, 11409420, 11901242, 12163376, 1303239, 15311281, 15365148, 15772340, 16133541, 16369530, 16485107, 16612980, 16783171, 16921174, 16959815, 18413473, 18413480, 18755411, 19457117, 19684239, 20739292, 21463452, 22116809, 22355794, 25828868, 26556230, 26707129, 27858710, 28304299, 28870521, 29506560, 29706885, 29770843, 31278851, 7482672, 7684195, 8532114, 9032652		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebral Amyloid Angiopathy	Cerebral amyloid angiopathy	LHGDN	12480759, 12944403, 15365148, 16485107, 16555084, 18413480, 19139910		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebral Amyloid Angiopathy	Cerebral amyloid angiopathy	Pubtator	19743453	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebral Amyloid Angiopathy	Cerebral amyloid angiopathy	CTD_human_DG	21520056		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebral Amyloid Angiopathy	Cerebral amyloid angiopathy	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebral Amyloid Angiopathy Familial	Cerebral amyloid angiopathy	Pubtator	10734132, 10800967, 18055545, 19189048, 32518112, 33805778, 8644866, 8955370	Associate	★☆☆☆☆ Found in Text Mining only
CEREBRAL AMYLOID ANGIOPATHY, APP-RELATED	Cerebral amyloid angiopathy	CTD_human_DG	10821838, 2111584		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
CEREBRAL AMYLOID ANGIOPATHY, APP-RELATED	Cerebral amyloid angiopathy	UNIPROT_DG	11409420, 12654973, 16178030, 20697050, 2111584		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
CEREBRAL AMYLOID ANGIOPATHY, APP-RELATED	Cerebral amyloid angiopathy	GENOMICS_ENGLAND_DG	20228223, 2111584		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
CEREBRAL AMYLOID ANGIOPATHY, APP-RELATED	Cerebral amyloid angiopathy	CLINVAR_DG			★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
CEREBRAL AMYLOID ANGIOPATHY, APP-RELATED, ARCTIC VARIANT	Cerebral Amyloid Angiopathy	CTD_human_DG	10821838, 2111584		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBRAL AMYLOID ANGIOPATHY, APP-RELATED, FLEMISH VARIANT	Cerebral Amyloid Angiopathy	CTD_human_DG	10821838, 2111584		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBRAL AMYLOID ANGIOPATHY, APP-RELATED, IOWA VARIANT	Cerebral Amyloid Angiopathy	CTD_human_DG	10821838, 2111584		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBRAL AMYLOID ANGIOPATHY, APP-RELATED, ITALIAN VARIANT	Cerebral Amyloid Angiopathy	CTD_human_DG	10821838, 2111584		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebral Amyloid Angiopathy, Hereditary	Cerebral Amyloid Angiopathy	BEFREE	10671319, 1679289, 18413480, 1971458, 20697050, 8515875, 8955370, 9754958		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebral atrophy	Cerebral Atrophy	BEFREE	24885175		★☆☆☆☆ Found in Text Mining only
Cerebral cortical atrophy	Cerebral cortical atrophy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Cerebral Hemorrhage	Cerebral hemorrhage	Pubtator	10821838, 10861242, 11004129, 16027166, 18413473, 19770225, 22156599, 33918046, 8610157	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral hemorrhage with amyloidosis, hereditary, Dutch type	Cerebral Amyloid Angiopathy	BEFREE	10320740, 10359654, 14678776, 1679288, 17628026, 1763898, 24646423, 29706885, 30611017, 7684195, 8239272, 8644866, 9063500		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebral hemorrhage with amyloidosis, hereditary, Dutch type	Cerebral Amyloid Angiopathy	CTD_human_DG	10821838, 2111584		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebral hemorrhage with amyloidosis, hereditary, Dutch type	Cerebral Amyloid Angiopathy	ORPHANET_DG	24870607		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebral Infarction	Cerebral Infarction	BEFREE	18063223		★☆☆☆☆ Found in Text Mining only
Cerebral Small Vessel Diseases	Cerebral microangiopathy	Pubtator	19153374, 25355827, 37950256	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	11901242, 12163376, 12654973, 14678776, 17448150, 18063223, 19457117, 20934412, 24513321		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	GENOMICS_ENGLAND_DG	20228223		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	HPO_DG			★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular Disorders	BEFREE	14503015, 26159191, 31016510, 8170579		★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular disorder	Pubtator	25948718, 30576228, 32518112	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular Insufficiency	Cerebrovascular Insufficiency	BEFREE	27339263		★☆☆☆☆ Found in Text Mining only
Charcot-Marie-Tooth Disease	Charcot-Marie-Tooth Disease	BEFREE	15857389		★☆☆☆☆ Found in Text Mining only
CHARCOT-MARIE-TOOTH DISEASE, AXONAL, TYPE 2Q	Charcot-Marie-Tooth Disease	BEFREE	29661920		★☆☆☆☆ Found in Text Mining only
Charcot-Marie-Tooth Disease, Type Ia (disorder)	Charcot-Marie-Tooth disease	BEFREE	19525893		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	29775888		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	30610438		★☆☆☆☆ Found in Text Mining only
Classical phenylketonuria	Phenylketonuria	BEFREE	11772995		★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	11829347, 15899498, 25204496, 7576662		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	10527458, 11279122, 11425896, 12544850, 15578094, 16187206, 18772249, 19101630, 19228952, 20739292, 22014620, 22212065, 22248049, 22342341, 23121022, 23447589, 23595759, 23685322, 23968591, 24373902, 24604080, 24846616, 25502280, 25523423, 25566747, 25862638, 26062786, 26423933, 26646366, 26945731, 26991827, 27389178, 27431297, 27443159, 27474225, 27573878, 28065587, 28189498, 28191738, 28228716, 28241068, 28275722, 28337142, 28467789, 28533191, 28849459, 28865749, 28970251, 29036636, 29163135, 29197516, 29217476, 29285052, 29378298, 29454025, 29468792, 29520217, 29581300, 29728920, 29739836, 29860433, 29920069, 29922152, 30047036, 30237878, 30320577, 30504006, 30816709, 30894120, 30972181, 31190768, 31286344, 31467256, 31601077, 31603034, 31685977, 31763156, 31778727, 31783135, 31792284, 31839610, 31847879		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cognition Disorders	Cognitive disorder	CTD_human_DG	17406652, 17600377, 21350020, 24189446, 26945731		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cognition Disorders	Cognition disorder	Pubtator	17601350, 19346482, 20338079, 20414590, 20697031, 21035623, 21280088, 21526197, 21551363, 22637583, 22640423, 22695614, 22965806, 23100439, 23474040, 23479184, 23635404, 23673467, 23779114, 23825179, 23946416, 24164736, 24186361, 24326519, 24529499, 24748674, 25088003, 25288138, 25596881, 25678559, 25808939, 26221954, 26244608, 26430784, 26843008, 27776263, 27832767, 28731444, 28842444, 29061195, 29096697, 29156223, 29374250, 29394903, 29592889, 29807259, 29934873, 29959263, 29960604, 30320574, 30569084, 30826425, 30856114, 31127775, 31370031, 31511058, 31634898, 31796668, 31810489, 32057937, 32067693, 32091549, 32142100, 32250387, 32641719, 32911327, 32928967, 33044487, 33082443, 33213489, 33239403, 33303945, 33331917, 33439987, 33475074, 34002691, 34258926, 34285331, 34473944, 34493616, 34601245, 35061102, 35212149, 35351867, 35380901, 35831715, 36271678, 36406589, 36745413, 36892415, 37085326, 37173305, 37188537, 37231665, 37801139, 37918868, 38165363, 38454193, 38593527, 39827005, 39940679, 40051075, 40122980, 40551292	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cognition Disorders	Cognition disorder	Pubtator	24843230, 28468845, 34218796, 39670385	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cognition Disorders	Cognition disorder	Pubtator	25072319, 29415768	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cognitive Dysfunction	Cognition disorder	Pubtator	20338079, 20541286, 21280088, 23635404, 24475133, 25040401, 25288138, 26221954, 26843008, 26940242, 27229352, 27521573, 27748454, 28034305, 28634213, 28777752, 28879083, 29135331, 29356823, 29592889, 29980228, 30419087, 30923322, 31376643, 31796668, 31884486, 33030915, 33213489, 33215319, 33408147, 35831715, 36448771, 36522743, 38454193	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cognitive Dysfunction	Cognition disorder	Pubtator	21700583, 23613741, 36773106, 39827005, 39940679	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cognitive Dysfunction	Cognition disorder	Pubtator	37742656	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colitis	Colitis	BEFREE	21693591		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	20145244, 29128960		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	21041478		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	26074693		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	26074693, 35962130	Associate	★☆☆☆☆ Found in Text Mining only
Complement component 3 deficiency	C3 Deficiency	BEFREE	28566429		★☆☆☆☆ Found in Text Mining only
Congenital dyserythropoietic anemia	Congenital dyserythropoietic anemia	BEFREE	23056220		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	28158647, 30371165		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	35938548	Associate	★☆☆☆☆ Found in Text Mining only
Cortical cataract	Cortical cataract	BEFREE	22984439		★☆☆☆☆ Found in Text Mining only
Corticobasal Degeneration	Corticobasal degeneration	Pubtator	21455839	Associate	★☆☆☆☆ Found in Text Mining only
Craniocerebral Trauma	Craniocerebral trauma	Pubtator	10079962, 19542221	Associate	★☆☆☆☆ Found in Text Mining only
Creutzfeldt-Jakob Disease, Sporadic	Creutzfeldt-Jakob disease	BEFREE	18349519		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	1424287	Stimulate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	32724827, 40182599	Associate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	14525626	Associate	★☆☆☆☆ Found in Text Mining only
Cytochrome c Oxidase Deficiency	Cytochrome c oxidase deficiency	Pubtator	19350381	Inhibit	★☆☆☆☆ Found in Text Mining only
Degenerative Diseases, Central Nervous System	Degenerative Diseases, Central Nervous System	CTD_human_DG	16122394, 23541064		★☆☆☆☆ Found in Text Mining only
Degenerative Diseases, Spinal Cord	Degenerative Diseases, Central Nervous System	CTD_human_DG	16122394, 23541064		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	21899735		★☆☆☆☆ Found in Text Mining only
Deglutition Disorders	Dysphagia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Delirium	Delirium	Pubtator	39210294	Associate	★☆☆☆☆ Found in Text Mining only
Delirium, Dementia, Amnestic, Cognitive Disorders	Delirium, Dementia, Amnestic, Cognitive Disorders	BEFREE	29118375		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dementia	Dementia	Pubtator	10220456, 10631141, 12058030, 15983050, 16027166, 17254013, 17344400, 17620492, 19221430, 19571732, 19770225, 20663017, 21193246, 21297263, 21841249, 22343824, 22499763, 22503161, 22514144, 22732677, 23137949, 23268705, 24359497, 25088003, 25355827, 25575135, 25655625, 25678559, 25707004, 26410307, 26527105, 27589530, 28842697, 29397305, 29660943, 29960604, 29980228, 30320574, 30917570, 31177226, 31195602, 31601267, 31805990, 32161362, 32250387, 33061333, 33215319, 34601245, 34913545, 35831715, 40122980, 40551292, 40664837, 8579098	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dementia	Dementia	BEFREE	10636133, 10702374, 11004129, 11119687, 11409420, 11773429, 11901242, 11983636, 12223532, 12893422, 14678776, 15184603, 15258222, 15311281, 15312913, 15363602, 15365148, 15755621, 16027166, 16125396, 16677790, 16815323, 17627113, 17716740, 18344047, 19164507, 19329229, 20225047, 21193246, 21241773, 21660677, 21880397, 22170863, 22514144, 22545812, 22727994, 22935789, 23447608, 23931937, 24279603, 24990930, 25119742, 25604855, 25710536, 26159191, 26242991, 26528887, 26651340, 27983553, 28079014, 28360834, 28509380, 28626014, 28655199, 28870521, 29329714, 29383688, 29558979, 29788013, 29879605, 30246866, 30504006, 30529693, 30703749, 30802839, 30814347, 31496118, 31535637, 7504355, 8028788, 8140621, 9225691, 9425253		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dementia	Dementia	LHGDN	14676049, 15184603, 16651889, 17339876, 17442758, 18300294, 18541797, 18955727		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dementia	Dementia	CTD_human_DG	22300406		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dementia	Dementia	GENOMICS_ENGLAND_DG	22503161, 23028126		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dementia	Dementia	Pubtator	31849332	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dementia	Dementia	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dementia familial Danish	Dementia	Pubtator	20228223, 21841249, 36102248	Associate	★☆☆☆☆ Found in Text Mining only
Dementia, familial Danish	Dementia	BEFREE	22170863		★☆☆☆☆ Found in Text Mining only
Dementia, Vascular	Dementia	BEFREE	12627474		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dental Caries	Dental caries	Pubtator	33912975	Associate	★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	PSYGENET_DG	10364642, 11315514, 20664629, 22228829, 24664800		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder	Major depressive disorder	Pubtator	19812466	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder	Major depressive disorder	Pubtator	23928361, 31931428	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	BEFREE	25224257, 28358367, 29241655		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder	Major depressive disorder	Pubtator	36040555, 37258256	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder Major	Major depressive disorder	Pubtator	30445590	Associate	★☆☆☆☆ Found in Text Mining only
Deuteranomaly	Deuteranomaly	BEFREE	26936765		★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Development Disorder	BEFREE	27327493		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	19046405, 19879019, 19931251, 25882165, 28710249, 30072873, 31454789		★☆☆☆☆ Found in Text Mining only
Diabetes Complications	Diabetes complications	Pubtator	20943659	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Insipidus	Diabetes Insipidus	BEFREE	10911966, 11124436		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	17613531, 19896952, 21185309, 36374264	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	19046405, 19879019, 19931251, 25882165, 28710249, 30072873, 30371165, 31454789		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	18316396, 24130366, 33832546, 37506364	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	22174920, 22500019, 28684415	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	19931251, 22938075, 29251519		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	24376773, 26916443, 27730513, 28349564, 29147492, 29263141, 29962282, 30759264, 31527120, 31722714, 31838720		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	12967475		★☆☆☆☆ Found in Text Mining only
Distal myopathy Nonaka type	Distal myopathy	Pubtator	23472144	Associate	★☆☆☆☆ Found in Text Mining only
Distal myopathy Nonaka type	Distal myopathy	Pubtator	9546349	Stimulate	★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	10051452, 10880397, 15255950, 16608822, 16685645, 16904243, 19542221, 19571732, 20502642, 21273664, 21958962, 22009041, 22344463, 23102120, 24927707, 24995708, 26079411, 26103884, 26166206, 26448035, 26936520, 27983553, 28250274, 28554490, 2973063, 29752653, 29861166, 30032260, 30734106, 31043483, 31479861, 31902793, 32192521, 33848613, 34040082, 34302786, 34795060, 34961556, 35532913, 36952379, 40334312, 40545561, 40595720, 8088823, 8952519	Associate	★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	10636471, 10666670, 10666673, 10666681, 11238715, 11771756, 11858695, 11983636, 12210526, 12525890, 12890557, 12890772, 15021233, 15184603, 15192323, 15255950, 15290893, 15639316, 16126912, 16608822, 16685645, 16815330, 16816112, 16891409, 17121991, 17168651, 17293612, 17361036, 17427190, 17559337, 17586478, 17826910, 18005339, 18038275, 18184371, 1851527, 18623069, 18823960, 1900367, 19625522, 20032300, 20080541, 21241773, 21266456, 21779383, 21944886, 22935789, 23041301, 23143229, 23740250, 23935819, 2400606, 24086147, 24262202, 24331439, 24773620, 24935721, 2527801, 2569883, 26079411, 26103884, 26194181, 26651340, 26936520, 27983553, 28003277, 28059787, 28250274, 28285880, 28359846, 28603769, 28677143, 28870521, 28899917, 28935420, 28988799, 29195510, 29215943, 29383688, 29391027, 29477284, 29628304, 2973063, 29752653, 29770843, 29861166, 29945247, 30031727, 30032260, 30086988, 30243157, 30389461, 30581976, 30612744, 30823541, 30902060, 31043483, 31133787, 31176774, 31389185, 31479861, 31605772, 7478160, 7897394, 8047269, 8239320, 8276862, 8427604, 8564851, 8746452, 8773595, 8856679, 8977148, 9146996, 9173910, 9189907, 9737546, 9754878, 9928821		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	LHGDN	11879646, 15184603, 15255950, 16608822, 16846375, 16865398, 17914261		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	17620492, 21116050, 24888381, 30031727, 30359879, 30902060, 34462463, 7724603, 9173910	Stimulate	★☆☆☆☆ Found in Text Mining only
Drusen	Drusen	BEFREE	25456519		★☆☆☆☆ Found in Text Mining only
Dyscalculia	Dyscalculia	BEFREE	8239283		★☆☆☆☆ Found in Text Mining only
Dysgraphia	Dysgraphia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Early-onset autosomal dominant Alzheimer disease	Alzheimer disease	Orphanet			★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Ectodermal Dysplasia	Ectodermal dysplasia	Pubtator	37379733	Associate	★☆☆☆☆ Found in Text Mining only
Elejalde Disease	Hereditary elliptocytosis	Pubtator	30403186	Stimulate	★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	11829347, 12646202, 17536186, 21899735, 26119225, 26646366		★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	Pubtator	14997933	Associate	★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	LHGDN	17536186		★☆☆☆☆ Found in Text Mining only
Encephalopathies	Epileptic encephalopathy	CTD_human_DG	11800653		★☆☆☆☆ Found in Text Mining only
Encephalopathies	Epileptic encephalopathy	BEFREE	29410317		★☆☆☆☆ Found in Text Mining only
Endogenous depression	Mental Depression	PSYGENET_DG	19955554		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epilepsies Myoclonic	Myoclonic epilepsy	Pubtator	31831060	Stimulate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	22702962, 37541842, 38289539, 7931344	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	23034178, 30127003, 31781019		★☆☆☆☆ Found in Text Mining only
Epilepsy Absence	Absence epilepsy	Pubtator	30152135	Stimulate	★☆☆☆☆ Found in Text Mining only
Epilepsy Temporal Lobe	Temporal lobe epilepsy	Pubtator	31834353	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	28595035, 29665128, 30484111		★☆☆☆☆ Found in Text Mining only
Episodic Kinesigenic Dyskinesia 1	Episodic Kinesigenic Dyskinesia	BEFREE	31373844		★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	36941702	Associate	★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	BEFREE	10101252, 10529469, 10575009, 10582589, 10617132, 10631141, 10850859, 10899440, 10934205, 10936878, 11119687, 11144356, 11193144, 11193154, 11266019, 11277983, 11288146, 11526104, 11544953, 11698669, 11717357, 11724784, 11744168, 11772995, 12059037, 12374741, 12390529, 12435726, 12472467, 12480183, 12730216, 12799176, 1303172, 1303239, 1303289, 1415269, 14623725, 14636889, 1465129, 1465214, 14751770, 1508403, 15119738, 15201367, 1520398, 15312963, 15474359, 15488330, 15534244, 15584903, 15663477, 1574806, 15766275, 15776278, 1584463, 1584464, 15975068, 15992373, 16181736, 16413130, 1642228, 16574645, 1671712, 16817891, 16908971, 16908988, 16923170, 17047361, 17101228, 17197420, 17393484, 17630980, 1768858, 18234110, 18266116, 18430735, 18438935, 18509095, 18575606, 18675254, 18768471, 18823960, 19056463, 1908231, 19286555, 19306098, 1944558, 19560104, 1971458, 19828212, 20032300, 20197417, 20332427, 20452985, 20594619, 20701429, 20842367, 20862215, 20919856, 21115843, 21193246, 21239495, 21681798, 21779722, 21795681, 21816272, 21994399, 22042871, 22115042, 22188425, 22232349, 22450047, 22558227, 23085935, 23907250, 23933749, 23935819, 24225948, 24256243, 24463146, 24481173, 24524897, 24625695, 24646423, 24694184, 2510039, 25127478, 25307057, 25376379, 25639959, 25694106, 25748120, 26051801, 26528887, 26566997, 26768426, 26942869, 27060961, 27572246, 27601731, 27687728, 27732852, 28049728, 28279219, 28366226, 28577205, 28626014, 28760161, 28852095, 28984594, 2901095, 29109429, 29614673, 29614680, 29619615, 2973063, 29966005, 30040726, 30099334, 30320594, 30598257, 30682043, 30822634, 30823541, 30851551, 30980041, 31011484, 31020001, 31191427, 31235642, 31416668, 31496118, 31606858, 31625391, 31697913, 31699328, 31705489, 31838720, 31849608, 7605617, 7628638, 7686976, 7700569, 7723630, 7746463, 7808582, 7890753, 7970175, 7976784, 8012386, 8121639, 8168817, 8220435, 8223557, 8232942, 8239283, 8352272, 8445394, 8461968, 8474686, 8476439, 8510829, 8515875, 8515885, 8573139, 8599933, 8624089, 8624126, 8650548, 8670881, 8728477, 8798542, 8845971, 8858181, 8867023, 8873125, 8938131, 8945747, 8955370, 9010004, 9045663, 9050898, 9171327, 9223097, 9257698, 9285791, 9305632, 9312066, 9354339, 9375682, 9514902, 9562461, 9572591, 9599080, 9632729, 9754958, 9781063, 9791531, 9791533, 9804121, 9920821, 9928821		★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	CTD_human_DG	12192006, 12572668, 12746438, 12852432, 1497677, 15590663, 15591071, 15993441, 16204253, 16266835, 16325427, 16492752, 16651627, 1671712, 1678058, 16969627, 17239395, 17430250, 18583042, 19286555, 19818510, 20111991, 20157255, 20640797, 21157020, 21209907, 21980910, 22507317, 23827522, 25352456, 25714973, 27117003, 28448946, 29420472, 30320580		★☆☆☆☆ Found in Text Mining only
Familial Cerebral Amyloid Angiopathy	Cerebral amyloid angiopathy	BEFREE	16000616, 1679289, 1971458, 8515875, 9754958		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial Dementia	Dementia	BEFREE	15983050, 26528887		★☆☆☆☆ Found in Text Mining only
Familial Dementia	Dementia	CTD_human_DG	22300406		★☆☆☆☆ Found in Text Mining only
Familial dilated cardiomyopathy	Cardiomyopathy	BEFREE	21482412		★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Fatigue syndrome	Pubtator	39394558	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	31548551		★☆☆☆☆ Found in Text Mining only
Febrile Convulsions	Febrile seizures	HPO_DG			★☆☆☆☆ Found in Text Mining only
Focal cortical dysplasia of Taylor	Focal cortical dysplasia	Pubtator	23586324	Associate	★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	18480379		★☆☆☆☆ Found in Text Mining only
Fragile X Syndrome	Fragile X Syndrome	BEFREE	19918329, 26182420, 26398526, 27327493, 27664080, 28192196, 29134514		★☆☆☆☆ Found in Text Mining only
Fragile X Syndrome	Fragile X Syndrome	CTD_human_DG	22046307		★☆☆☆☆ Found in Text Mining only
FRAXA Syndrome	Fragile X syndrome	CTD_human_DG	22046307		★☆☆☆☆ Found in Text Mining only
FRAXE Syndrome	Fragile X syndrome	CTD_human_DG	22046307		★☆☆☆☆ Found in Text Mining only
Frontotemporal dementia	Frontotemporal dementia	BEFREE	15664690, 26159191, 28303975, 28304299, 29729423, 30291183		★☆☆☆☆ Found in Text Mining only
Frontotemporal Dementia	Frontotemporal dementia	Pubtator	20802215, 24041307, 30981993, 40055834	Associate	★☆☆☆☆ Found in Text Mining only
Frontotemporal Lobar Degeneration	Frontotemporal dementia	BEFREE	30297518, 31789459		★☆☆☆☆ Found in Text Mining only
Gangliosidosis GM1	Gangliosidosis	BEFREE	20864542		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal disease	Pubtator	33048222	Associate	★☆☆☆☆ Found in Text Mining only
Gaucher Disease, Type 3 (disorder)	Gaucher Disease	BEFREE	24599400		★☆☆☆☆ Found in Text Mining only
Germ cell tumor	Tumor	BEFREE	22305861		★☆☆☆☆ Found in Text Mining only
Gerstmann-Straussler-Scheinker Disease	Gerstmann-Straussler-Scheinker syndrome	BEFREE	1679288		★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	24073598		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	18521005, 19860724, 23443094, 2507928, 28243115, 8466480		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	LHGDN	18521005		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	35797221, 38148047, 7592834, 8077213	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	18521005, 19860724, 23443094, 2507928		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	28789439		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	38148047, 40595248	Associate	★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	HPO_DG			★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	9893119	Associate	★☆☆☆☆ Found in Text Mining only
Glucose Metabolism Disorders	Glucose Metabolism Disorders	BEFREE	27763550		★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	27724812	Inhibit	★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	32241852	Associate	★☆☆☆☆ Found in Text Mining only
Growth Hormone Deficiency With Pituitary Anomalies	Growth hormone deficiency with pituitary anomalies	Pubtator	28349199	Associate	★☆☆☆☆ Found in Text Mining only
Hallucinations	Hallucinations	HPO_DG			★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	10079962	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	20080541, 27908343, 38165363	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	28158647, 30371165		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	26659918	Associate	★☆☆☆☆ Found in Text Mining only
Hemolysis	Hemolysis	Pubtator	36448495	Associate	★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	11004129, 19770225, 20576603, 21707819, 22695614	Associate	★☆☆☆☆ Found in Text Mining only
Hemorrhagic Stroke	Hemorrhagic stroke	Pubtator	10800967, 10821838, 12753080, 17448150	Associate	★☆☆☆☆ Found in Text Mining only
Hepatic Encephalopathy	Hepatic Encephalopathy	BEFREE	28618192		★☆☆☆☆ Found in Text Mining only
Hereditary Cerebral Amyloid Angiopathy, Icelandic Type	Hereditary Cerebral Amyloid Angiopathy	BEFREE	10524281		★☆☆☆☆ Found in Text Mining only
Hereditary Nonpolyposis Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	12215842		★☆☆☆☆ Found in Text Mining only
Hereditary pancreatitis	Hereditary Pancreatitis	BEFREE	12893422		★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung Disease	BEFREE	30217742		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	15538967, 25043050, 8445394		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	25043050, 32804976	Associate	★☆☆☆☆ Found in Text Mining only
Hydrocephalus	Hydrocephalus	Pubtator	22186713, 28212403	Stimulate	★☆☆☆☆ Found in Text Mining only
Hydrocephalus	Hydrocephalus	BEFREE	27571524		★☆☆☆☆ Found in Text Mining only
Hydrocephalus Normal Pressure	Normal pressure hydrocephalus	Pubtator	27472944	Inhibit	★☆☆☆☆ Found in Text Mining only
Hydrocephalus Normal Pressure	Normal pressure hydrocephalus	Pubtator	31849332, 33720890	Associate	★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	23805206, 25947203, 26428672		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	Pubtator	31929164	Stimulate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	22414803, 30909245, 31130652		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	23894546, 26842741	Stimulate	★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	BEFREE	27656027		★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	27177549		★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	31831374, 36374264, 36941702	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	16458426, 19879019, 28760945, 30176844		★☆☆☆☆ Found in Text Mining only
Hyperthyroidism	Hyperthyroidism	BEFREE	17199430		★☆☆☆☆ Found in Text Mining only
Hypocholesterolemia	Hypocholesterolemia	BEFREE	12754201		★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	31143098		★☆☆☆☆ Found in Text Mining only
Hypotension	Hypotension	Pubtator	23276181	Associate	★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	BEFREE	20403092		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	12050157	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	18326038, 26924229, 30355438	Stimulate	★☆☆☆☆ Found in Text Mining only
Ichthyosis linearis circumflexa	Netherton syndrome	BEFREE	26502822		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	10065997, 10513583, 10527458, 10578233, 10681074, 11279122, 11425896, 12544850, 12802876, 15114629, 15193763, 15578094, 16187206, 17047360, 18040847, 18202172, 18509040, 18772249, 19101630, 19228952, 19329229, 20002203, 20430437, 20505099, 20595065, 20641005, 20739292, 21305033, 21658330, 21775587, 21798347, 21903077, 22014620, 22212065, 22248049, 22342341, 22727994, 22801501, 23121022, 23447589, 23447608, 23595759, 23652020, 23685322, 23968591, 24004423, 24289518, 24373902, 24400342, 24604080, 24684630, 24846616, 24903713, 25025046, 25171128, 25502280, 25523423, 25533482, 25566747, 25661995, 25862638, 26062786, 26196079, 26202697, 26293690, 26391026, 26423933, 26646366, 26945731, 26991827, 27240542, 27389178, 27392857, 27431297, 27443159, 27474225, 27531392, 27573878, 27861127, 27889678, 28025127, 28065587, 28108292, 28189498, 28191738, 28228716, 28241068, 28261092, 28275722, 28336433, 28337142, 28365686, 28377712, 28397068, 28467789, 28533191, 28603494, 28697571, 28741167, 28744803, 28753016, 28756309, 28776265, 28826672, 28849459, 28865290, 28865749, 28931427, 28970251, 29036636, 29073110, 29100755, 29114922, 29163135, 29190943, 29197516, 29217476, 29285052, 29323336, 29331876, 29378298, 29429523, 29454025, 29468792, 29477284, 29520217, 29563870, 29581300, 29604345, 29636677, 29683360, 29728920, 29736217, 29739836, 29775888, 29781405, 29807259, 29843688, 29860433, 29920069, 29922152, 30031059, 30047036, 30172223, 30237878, 30320577, 30366065, 30374941, 30382187, 30389579, 30447302, 30504006, 30530690, 30537634, 30582229, 30610438, 30627958, 30687079, 30756214, 30795807, 30816709, 30870684, 30877730, 30894120, 30972181, 31016510, 31024293, 31086391, 31087219, 31121203, 31130652, 31190768, 31223308, 31237989, 31286344, 31311447, 31373375, 31386938, 31445975, 31467256, 31551717, 31601077, 31603034, 31685977, 31720368, 31738978, 31763156, 31778727, 31783135, 31792284, 31810113, 31816602, 31831179, 31835282, 31839610, 31847879, 7777509, 8239283, 9189907		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	CTD_human_DG	25288670		★☆☆☆☆ Found in Text Mining only
INCLUSION BODY MYOPATHY WITH EARLY-ONSET PAGET DISEASE AND FRONTOTEMPORAL DEMENTIA	Inclusion Body Myopathy With Paget Disease And Frontotemporal Dementia	BEFREE	28303975		★☆☆☆☆ Found in Text Mining only
Inclusion Body Myopathy, Sporadic	Inclusion body myopathy	BEFREE	12787072, 16104000, 16432135, 18420712, 18946325, 9855208		★☆☆☆☆ Found in Text Mining only
Inclusion Body Myositis (disorder)	Inclusion Body Myositis	BEFREE	11972038, 16940437, 22518836, 9243602, 9855208		★☆☆☆☆ Found in Text Mining only
Insomnia Fatal Familial	Insomnia	Pubtator	39716111	Associate	★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	18483477, 22297646, 27207326, 33267804, 33832546	Associate	★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	27079723	Stimulate	★☆☆☆☆ Found in Text Mining only
Insulin-Like Growth Factor I Deficiency	Insulin-Like Growth Factor I Deficiency	BEFREE	22230888		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	15290893, 16891409, 21241773, 22824307, 26182420		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	23102120	Stimulate	★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	HPO_DG			★☆☆☆☆ Found in Text Mining only
Intracranial Hemorrhages	Intracranial hemorrhage	Pubtator	25828868	Associate	★☆☆☆☆ Found in Text Mining only
Iron Metabolism Disorders	Iron Metabolism Disorders	BEFREE	31373375		★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron Overload	BEFREE	24513321, 28836584, 31373375		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	GENOMICS_ENGLAND_DG	20228223		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	31535637		★☆☆☆☆ Found in Text Mining only
Juvenile Neuronal Ceroid Lipofuscinosis	Neuronal Ceroid Lipofuscinosis	BEFREE	30406174		★☆☆☆☆ Found in Text Mining only
Keratosis	Keratosis	Pubtator	29487944	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	29576405		★☆☆☆☆ Found in Text Mining only
Language Disorders	Language Disorders	HPO_DG			★☆☆☆☆ Found in Text Mining only
Learning Disabilities	Learning Disorders	CTD_human_DG	16474004, 18533140, 20816828, 22484447, 25213453, 26420483, 27306655, 29729307		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Learning Disorders	Learning Disorders	CTD_human_DG	16474004, 18533140, 20816828, 22484447, 25213453, 26420483, 27306655, 29729307		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Learning Disturbance	Learning Disorders	CTD_human_DG	16474004, 18533140, 20816828, 22484447, 25213453, 26420483, 27306655, 29729307		★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	Pubtator	7943169	Associate	★☆☆☆☆ Found in Text Mining only
Lesch-Nyhan Syndrome	Lesch-Nyhan Syndrome	BEFREE	24680827, 26398526, 28192196		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	15004329		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	23179400, 27460334		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	32241852	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	23179400	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	15007164, 23179400, 29399155, 31138842		★☆☆☆☆ Found in Text Mining only
Leukoencephalopathy	Leukoencephalopathy	GENOMICS_ENGLAND_DG	20228223		★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy body disease	Pubtator	10557341, 19759000, 22773458, 23133543, 25575135, 26527105, 28269775, 28800743, 37463072, 40051075	Associate	★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy Body Disease	BEFREE	15530662, 19606065, 25604855, 27312774		★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy Body Disease	LHGDN	16947080, 17339876, 18794492		★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy body disease	Pubtator	31601267	Inhibit	★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy body disease	Pubtator	35563582	Stimulate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	19815304, 27507654, 31548551		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	39341941	Associate	★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	31548551		★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis Hemophagocytic	Hemophagocytic lymphohistiocytosis	Pubtator	10498609	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	20423568	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Macular Degeneration	Macular degeneration	Pubtator	22382405, 24036938, 26467741, 28726777, 30849957, 31095924, 33374505, 37110558	Associate	★☆☆☆☆ Found in Text Mining only
Malformations of Cortical Development	Cortical development malformation	Pubtator	37379733	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	1531166, 23889773, 25491510, 28847292, 30108157, 30470613, 31746365		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	30394813		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	19117996, 31107971		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	28214529		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	30021247		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10348909, 17827153, 20145244, 23889773, 25491510, 25602368, 26840089, 27507654, 27836546, 28186401, 29587359, 30394813, 30500566, 30864510, 31138460, 31203623		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	20145244, 29128960		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	12958194		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	19759550		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	19759550, 35046061	Associate	★☆☆☆☆ Found in Text Mining only
Memory Disorders	Memory Disorders	CTD_human_DG	15364477, 18191838, 18599028, 19664757, 19770021, 20816828, 22484447, 23827522, 24858312, 25213453, 25881725, 26420483, 26480858, 27306655, 28448946, 29729307		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Memory Disorders	Memory disorders	Pubtator	20862329, 21652708, 21841249, 23100439, 24848988, 28720165, 30120417, 33504764, 35738259, 38165363	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Memory Disorders	Memory disorders	Pubtator	27258307, 30563962, 39670385	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Memory Disorders	Memory Disorders	BEFREE	28760161, 31720368		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Memory dysfunction	Memory Disorders	BEFREE	12544850, 12832546, 24466594, 26160914, 30676698		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	PSYGENET_DG	10364642, 11315514, 20664629, 22228829, 24664800		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	BEFREE	25224257, 28358367, 29241655		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Retardation	Mental retardation	BEFREE	15290893, 16891409, 21241773		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	28349564, 30592618, 31541119		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	31413575		★☆☆☆☆ Found in Text Mining only
Mevalonate Kinase Deficiency	Mevalonate kinase deficiency	Pubtator	10359654	Stimulate	★☆☆☆☆ Found in Text Mining only
Mevalonate Kinase Deficiency	Mevalonate kinase deficiency	Pubtator	10359654	Associate	★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	HPO_DG			★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	14769392, 20648652, 21954051, 22055653, 26159191, 26159193, 28034305, 28553223, 29053824, 29788013, 31505809		★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	CTD_human_DG	25288670		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	16943564, 21678067, 22077634, 22174920, 24140124, 25961951, 26813924, 27329039, 30103547, 30683981, 34366346, 8577761	Associate	★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	19496804, 23203093, 24905226, 24915567, 26010513, 26198711, 26542804, 27521081, 30310092, 30572643, 31159590, 32156251, 32367269, 36035216	Stimulate	★☆☆☆☆ Found in Text Mining only
Motor Neuron Disease	Motor Neuron Disease	BEFREE	19606065, 21385376, 8445394		★☆☆☆☆ Found in Text Mining only
Motor Neuron Disease	Motor neuron disease	Pubtator	23127958	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	28486965	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	15148385	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	26785938		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	24843230	Stimulate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	30076486		★☆☆☆☆ Found in Text Mining only
MYELOPROLIFERATIVE SYNDROME, TRANSIENT	Myeloproliferative disorder	BEFREE	18623069		★☆☆☆☆ Found in Text Mining only
Myocardial Diseases, Secondary	Myocardial Diseases	CTD_human_DG	29068127		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	30371165		★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	BEFREE	11358479, 22518836, 7654077, 7904883		★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	BEFREE	18946325		★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	Pubtator	7774065	Associate	★☆☆☆☆ Found in Text Mining only
Myositis Inclusion Body	Myositis	Pubtator	12787072, 14695312, 16049336, 16405511, 16441512, 17056255, 20616343, 25978849, 8577761, 9326287, 9546349	Associate	★☆☆☆☆ Found in Text Mining only
Myositis Inclusion Body	Myositis	Pubtator	20236612	Stimulate	★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	38165363	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	22869680, 22935999, 23382922, 31180550		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	31180550	Stimulate	★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	21272192, 22981873	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasms	Neoplasms	BEFREE	18430897, 19117996, 20145244, 25602368, 26261495, 26673618, 26840089, 27507654, 29128960, 29387243, 30021247, 30470613		★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	21398043	Stimulate	★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	30153862	Associate	★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	1331685, 20846516, 27571524, 28132929, 29032190		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	10861242, 12807963, 15251450, 15857408, 18194465, 19087254, 19350381, 19883607, 20490276, 20923778, 22108004, 22180352, 22867901, 23203093, 24473795, 26707976, 32224504, 34366346	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	11238715, 11526466, 11708617, 12198135, 12610653, 12927207, 13130517, 1334198, 14655750, 14997017, 15233804, 15314261, 15370186, 15519686, 15582280, 15681799, 1578514, 15959846, 16551656, 16928984, 16935943, 17199430, 17207630, 17401156, 17726461, 18208556, 18855586, 19057576, 19144697, 19167357, 19563806, 19679113, 19702658, 19707560, 19897485, 20554868, 21081501, 22306812, 22306846, 22412990, 22572541, 22734645, 22771396, 22867901, 22915123, 23812658, 24063855, 24205320, 24456637, 24473795, 24610780, 24671102, 25051175, 2507928, 25119316, 25288153, 25293506, 25841787, 26092426, 26198711, 26738850, 26854602, 27163814, 27522594, 27590054, 28140404, 28302486, 28476886, 28646018, 28855330, 29382536, 29458418, 29777707, 29914038, 30022810, 30102687, 30117120, 30138694, 30346715, 30394813, 30683981, 30723778, 31062249, 31143112, 31446431, 31588929, 31595293, 31604820, 31628935, 31795302, 8191290, 8239266, 8297361, 8392518, 8424174, 8562317, 9050898, 9121703, 9591705, 9813276		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	22580042	Stimulate	★☆☆☆☆ Found in Text Mining only
Neurocognitive Disorders	Neurocognitive Disorders	BEFREE	29118375		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	10487842, 16542157, 18378046, 19162185, 19483198, 19542221, 20943659, 21293490, 21652708, 22180352, 22267728, 22403062, 22477259, 22888099, 22976236, 23134284, 23474040, 23943781, 24014820, 24333289, 24359497, 24376773, 24468113, 24818077, 26410307, 27252381, 27662287, 28557010, 28720165, 29899186, 30477432, 30654492, 30914681, 31580390, 31831374, 33303945, 33720890, 33849647, 34035398, 34153352, 34252282, 34285331, 34593890, 35351867, 35781037, 35901928, 35960729, 35964194, 36002891, 36555510, 37110558, 37272536, 37735227, 39461112, 39684731, 9256259	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	20796026, 24326519, 28435263, 34591236, 36012298, 37620502, 40275379, 8922409	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	10675649, 11732892, 11917160, 15885086, 16954700, 17716740, 18406062, 19093876, 19166904, 19450683, 19860855, 21085580, 21406255, 21982844, 24680827, 25152461, 25619653, 26317805, 26398526, 27511641, 27829172, 27911893, 28192196, 28298885, 28411131, 28562045, 28696204, 28811634, 29061112, 29079999, 29092397, 29107423, 29118375, 29383688, 29426354, 29587274, 30471088, 30951743, 30971876, 31148450, 31655280, 31680172, 8294927, 9288730		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurodegenerative Disorders	Neurodegenerative Disorders	CTD_human_DG	16122394, 23541064		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurodevelopmental Disorders	Neurodevelopmental Disorders	BEFREE	28102781		★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	BEFREE	16374483		★☆☆☆☆ Found in Text Mining only
Neuronal Ceroid-Lipofuscinoses	Neuronal Ceroid Lipofuscinosis	BEFREE	30406174		★☆☆☆☆ Found in Text Mining only
Niemann-Pick Disease, Type C	Niemann-Pick Disease	BEFREE	20138836, 21205675, 22869680, 22935999, 23382922, 23443094, 31847862		★☆☆☆☆ Found in Text Mining only
Night blindness congenital stationary	Night blindness, congenital stationary	Pubtator	24326519, 30914681, 31208071, 36142742	Associate	★☆☆☆☆ Found in Text Mining only
Night blindness congenital stationary	Night blindness, congenital stationary	Pubtator	26658733	Stimulate	★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	26728181, 28796060, 31130652, 31413575		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	25502341, 31138460		★☆☆☆☆ Found in Text Mining only
NONAKA MYOPATHY	Inclusion body myopathy	BEFREE	23496965, 30374284		★☆☆☆☆ Found in Text Mining only
Nuclear non-senile cataract	Cataract	BEFREE	26502822		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	18483477, 19672057, 21538175, 22508715, 28349564, 28659580, 28814391, 29526536, 29674342, 29905772, 30096853, 30538277, 31130652, 31454789, 31541119		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	18483477	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	34689144, 39210402	Inhibit	★☆☆☆☆ Found in Text Mining only
Oculocutaneous albinism type 1	Oculocutaneous albinism	Pubtator	37569528	Associate	★☆☆☆☆ Found in Text Mining only
Oculomotor apraxia	Oculomotor apraxia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Oculovestibuloauditory syndrome	Oculovestibuloauditory Syndrome	HPO_DG			★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	23889773		★☆☆☆☆ Found in Text Mining only
Optic Atrophy	Optic Atrophy	BEFREE	30252181		★☆☆☆☆ Found in Text Mining only
Osteitis Deformans	Paget disease	BEFREE	28303975		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	37188537	Associate	★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	17400654, 23649480		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	33055205	Inhibit	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	30394813		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	36837407	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	26261495		★☆☆☆☆ Found in Text Mining only
Papillary craniopharyngioma	Papillary Craniopharyngioma	BEFREE	30176342		★☆☆☆☆ Found in Text Mining only
Paralysis	Paralysis	Pubtator	27448508	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Paraparesis Spastic	Paraparesis	Pubtator	27614114, 35365805	Associate	★☆☆☆☆ Found in Text Mining only
Parathyroid Gland Adenocarcinoma	Parathyroid Gland Adenocarcinoma	BEFREE	15492263		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	12087131, 12392775, 12428718, 15538967, 18777128, 19606065, 24376773, 25604855, 25716857, 25808939, 28720718, 28843453, 29665066, 30055328		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	22170881, 23644819, 23825179, 25596881, 25604855, 25808939, 26497684, 26756745, 28395086, 28542444, 30826425, 31733655, 32753661, 33809978, 33832546	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	29030452, 34983390	Stimulate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	34285331	Inhibit	★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	BEFREE	28214264, 29589276, 30252181		★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	HPO_DG			★☆☆☆☆ Found in Text Mining only
Pelvic Organ Prolapse	Pelvic organ prolapse	Pubtator	30153862	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	24690593, 28285126		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	33486152	Associate	★☆☆☆☆ Found in Text Mining only
Peroxisome biogenesis disorders	Zellweger Syndrome	BEFREE	28521612		★☆☆☆☆ Found in Text Mining only
Pervasive Development Disorder	Autism spectrum disorder	BEFREE	31024350		★☆☆☆☆ Found in Text Mining only
Phenylketonurias	Phenylketonuria	BEFREE	11772995		★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	2474201, 28698968, 30509041		★☆☆☆☆ Found in Text Mining only
Pick Disease of the Brain	Pica	BEFREE	15664690, 19606065, 26611895, 28303975, 28304299, 29729423		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	38256230	Stimulate	★☆☆☆☆ Found in Text Mining only
Polyendocrinopathies, Autoimmune	Autoimmune Polyendocrinopathy	BEFREE	19282067		★☆☆☆☆ Found in Text Mining only
Premature aging syndrome	Premature aging	CTD_human_DG	23129026		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	10636133, 10702374, 11004129, 11119687, 11409420, 11773429, 11901242, 11983636, 12223532, 12893422, 1303239, 1307241, 14678776, 15184603, 15258222, 15311281, 15312913, 15363602, 15365148, 15755621, 16027166, 16125396, 16677790, 16815323, 17716740, 18344047, 19164507, 19329229, 20225047, 21193246, 21241773, 21660677, 21880397, 22170863, 22514144, 22545812, 22727994, 22935789, 23447608, 23931937, 24279603, 24990930, 25119742, 25604855, 25710536, 26159191, 26242991, 26651340, 27983553, 28079014, 28360834, 28509380, 28626014, 28655199, 28870521, 29383688, 29788013, 29879605, 30246866, 30504006, 30529693, 30703749, 30802839, 30814347, 31496118, 31535637, 7504355, 8028788, 8140621, 8321254, 9225691, 9425253		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	CTD_human_DG	12192006, 12572668, 12746438, 12852432, 1497677, 15590663, 15591071, 15993441, 16204253, 16266835, 16325427, 16492752, 16651627, 1671712, 1678058, 16969627, 17239395, 17430250, 18583042, 19286555, 19818510, 20111991, 20157255, 20640797, 21157020, 21209907, 21980910, 22507317, 23827522, 25352456, 25714973, 27117003, 28448946, 29420472, 30320580		★☆☆☆☆ Found in Text Mining only
Prion Diseases	Prion disease	Pubtator	19822779, 27016065, 29330303, 30961668, 36952379	Associate	★☆☆☆☆ Found in Text Mining only
Progressive supranuclear palsy	Progressive Supranuclear Palsy	BEFREE	26159191, 26936765		★☆☆☆☆ Found in Text Mining only
Progressive supranuclear palsy atypical	Progressive supranuclear palsy	Pubtator	17675576	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	19117996, 31107971		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	25305487, 35962130	Associate	★☆☆☆☆ Found in Text Mining only
Pseudohyperkalemia Cardiff	Pseudohyperkalemia Cardiff	BEFREE	28212403		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	19399181		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychotic disorders	Pubtator	21093110	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	32049827	Inhibit	★☆☆☆☆ Found in Text Mining only
Recurrent cerebral hemorrhage	Cerebral Hemorrhage	BEFREE	15534244		★☆☆☆☆ Found in Text Mining only
Recurrent cerebral hemorrhage	Cerebral Hemorrhage	HPO_DG			★☆☆☆☆ Found in Text Mining only
Retinal Degeneration	Retinal degeneration	Pubtator	24036938	Stimulate	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	23294492		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	22029666, 27623077		★☆☆☆☆ Found in Text Mining only
Sandhoff Disease	Sandhoff Disease	BEFREE	20864542		★☆☆☆☆ Found in Text Mining only
Sandhoff Disease	Sandhoff disease	Pubtator	23127958	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	28827283	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	1307241, 25224257, 25889058, 30055328, 7724053, 8291572		★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	38570030	Stimulate	★☆☆☆☆ Found in Text Mining only
Seborrheic keratosis	Seborrheic keratosis	BEFREE	29487944		★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	21193246	Associate	★☆☆☆☆ Found in Text Mining only
Semantic Dementia	Semantic Dementia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Senile Paranoid Dementia	Senile Paranoid Dementia	CTD_human_DG	22300406		★☆☆☆☆ Found in Text Mining only
Senile Plaques	Senile Plaques	BEFREE	10037734, 10192224, 10319819, 10336668, 10694577, 10804202, 11021833, 11409420, 11421596, 11525745, 11544953, 11732892, 11790115, 11816788, 11917160, 12124431, 12163376, 12223540, 12230328, 12393239, 12646202, 14517947, 14645205, 15148325, 15277614, 15452128, 15475626, 15698636, 15731448, 15876981, 15917101, 1593645, 16169151, 16174740, 16181410, 16413130, 16432149, 16485107, 16554819, 16608822, 16611010, 16816111, 16816112, 16876916, 1691865, 17003227, 17028556, 17121991, 17431643, 17451178, 17482359, 17505020, 17511654, 17561313, 18038275, 18045146, 18063223, 18603345, 18679696, 18751990, 19093876, 19465012, 19679638, 19914323, 20060866, 20400860, 20580132, 20641005, 20685197, 20813165, 20850464, 21112317, 2115911, 21329555, 21651910, 21726674, 21846988, 21955601, 22122349, 22184106, 22209004, 22795384, 23249141, 24055016, 24289518, 24970022, 2507928, 25092575, 25862638, 25927677, 26026644, 27058954, 27092780, 27287430, 27694908, 28096459, 28323038, 28382239, 28478508, 28501620, 28547526, 28628788, 28637503, 28740171, 28743670, 29018038, 29033790, 29038004, 29175631, 29190943, 29245900, 29551659, 29617703, 29628304, 29678763, 29703946, 29775888, 29991481, 30086988, 30260518, 30319394, 30382187, 30474774, 30502339, 30526133, 30530690, 30623730, 30760863, 30763650, 30827242, 30836275, 30837843, 30902970, 31010414, 31034995, 31109380, 31127445, 31273712, 31373844, 3140239, 31410002, 31448273, 31606373, 31702813, 31811496, 31816853, 7585189, 7592902, 7959080, 8239575, 8577398, 8620894, 8809275, 9041854, 9133629, 9278541, 9292695, 9591705, 9689469, 9754958, 9811940, 9989619		★☆☆☆☆ Found in Text Mining only
Senile Plaques	Senile Plaques	CTD_human_DG	19818510, 29729307		★☆☆☆☆ Found in Text Mining only
Sialic Acid Storage Disease, Finnish Type (disorder)	Sialic Acid Storage Disease	BEFREE	28455102		★☆☆☆☆ Found in Text Mining only
Sinus Thrombosis, Intracranial	Sinus Thrombosis, Intracranial	BEFREE	31640101		★☆☆☆☆ Found in Text Mining only
Situs Inversus	Situs Inversus	BEFREE	11829347		★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	25902739	Associate	★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	29487944	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	39456840	Stimulate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea Syndromes	Sleep apnea	Pubtator	24107601	Stimulate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea Syndromes	Sleep apnea	Pubtator	24439479	Inhibit	★☆☆☆☆ Found in Text Mining only
Sleep Apnea Syndromes	Sleep Apnea	BEFREE	30529693		★☆☆☆☆ Found in Text Mining only
Sleep Deprivation	Sleep deprivation	Pubtator	29632177	Stimulate	★☆☆☆☆ Found in Text Mining only
Sleep-Disordered Breathing	Sleep Apnea	BEFREE	30529693		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	28347232		★☆☆☆☆ Found in Text Mining only
SMITH-MCCORT DYSPLASIA 1	Smith-McCort Dysplasia	BEFREE	15221339		★☆☆☆☆ Found in Text Mining only
Spastic Ataxia	Spastic Ataxia	BEFREE	30252181		★☆☆☆☆ Found in Text Mining only
Spastic Paraplegia, Hereditary	Spastic paraplegia	BEFREE	27911893		★☆☆☆☆ Found in Text Mining only
Spinal Cord Diseases	Spinal Cord Diseases	CTD_human_DG	11800653		★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxia Type 2	Spinocerebellar Ataxia	BEFREE	27531668		★☆☆☆☆ Found in Text Mining only
SPONDYLOCARPOTARSAL SYNOSTOSIS SYNDROME	Spondylocarpotarsal Synostosis Syndrome	BEFREE	30149759		★☆☆☆☆ Found in Text Mining only
Sporadic Cerebral Amyloid Angiopathy	Cerebral amyloid angiopathy	BEFREE	21085603		★☆☆☆☆ Found in Text Mining only
Sporadic Cerebral Amyloid Angiopathy	Cerebral amyloid angiopathy	CTD_human_DG	21520056		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	15252842, 17651731, 20145244, 31138460		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	15252842		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	17651731, 28486965	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	31304688		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	28214529		★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	30686901	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	39702278	Associate	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	12163376, 30338813, 39824235, 8579098	Associate	★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	30703614		★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	15658002, 16400027, 17028556, 28663518, 29920069, 30515907		★☆☆☆☆ Found in Text Mining only
Thiamine Deficiency	Thiamine Deficiency	BEFREE	18406011, 29490669		★☆☆☆☆ Found in Text Mining only
Thrombasthenia	Thrombasthenia	Pubtator	15219201	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Nodule	Thyroid Nodule	BEFREE	18480379		★☆☆☆☆ Found in Text Mining only
Tongue Neoplasms	Tongue cancer	Pubtator	33174521	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	30108157		★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous sclerosis complex	Pubtator	23586324	Associate	★☆☆☆☆ Found in Text Mining only
TUBEROUS SCLEROSIS 2 (disorder)	Tuberous Sclerosis	BEFREE	19631745		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	16555084, 18289733, 29344304		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	35351867, 38353984	Associate	★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	39752902	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular Fibrillation	Ventricular fibrillation	Pubtator	17170111, 33004626	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular Septal Defects	Ventricular septal defect	BEFREE	28553678		★☆☆☆☆ Found in Text Mining only
Vitamin A Deficiency	Vitamin A Deficiency	BEFREE	27335034		★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin d deficiency	Pubtator	34685653	Inhibit	★☆☆☆☆ Found in Text Mining only
Wallerian Degeneration	Wallerian degeneration	Pubtator	23354834	Associate	★☆☆☆☆ Found in Text Mining only