Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	349667
Gene name	Reticulon 4 receptor like 2
Gene symbol	RTN4RL2
Synonyms (NCBI Gene)	NGRH1NgR2
Chromosome	11
Chromosome location	11q12.1

Show/Hide all (20)

miRTarBase ID	miRNA	Experiments	Reference
MIRT489088	hsa-miR-5587-3p	PAR-CLIP	23592263
MIRT489087	hsa-miR-1203	PAR-CLIP	23592263
MIRT489086	hsa-miR-4743-5p	PAR-CLIP	23592263
MIRT489084	hsa-miR-6781-5p	PAR-CLIP	23592263
MIRT489085	hsa-miR-128-1-5p	PAR-CLIP	23592263
MIRT489083	hsa-miR-128-2-5p	PAR-CLIP	23592263
MIRT489082	hsa-miR-363-5p	PAR-CLIP	23592263
MIRT489081	hsa-miR-6745	PAR-CLIP	23592263
MIRT489080	hsa-miR-8071	PAR-CLIP	23592263
MIRT489079	hsa-miR-6786-5p	PAR-CLIP	23592263
MIRT489088	hsa-miR-5587-3p	PAR-CLIP	23592263
MIRT489087	hsa-miR-1203	PAR-CLIP	23592263
MIRT489086	hsa-miR-4743-5p	PAR-CLIP	23592263
MIRT489084	hsa-miR-6781-5p	PAR-CLIP	23592263
MIRT489085	hsa-miR-128-1-5p	PAR-CLIP	23592263
MIRT489083	hsa-miR-128-2-5p	PAR-CLIP	23592263
MIRT489082	hsa-miR-363-5p	PAR-CLIP	23592263
MIRT489081	hsa-miR-6745	PAR-CLIP	23592263
MIRT489080	hsa-miR-8071	PAR-CLIP	23592263
MIRT489079	hsa-miR-6786-5p	PAR-CLIP	23592263

Show/Hide all (27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005576	Component	Extracellular region	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	12694398
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007166	Process	Cell surface receptor signaling pathway	ISS
GO:0009897	Component	External side of plasma membrane	IBA
GO:0009986	Component	Cell surface	IDA	20463223
GO:0010977	Process	Negative regulation of neuron projection development	IEA
GO:0010977	Process	Negative regulation of neuron projection development	ISS
GO:0016020	Component	Membrane	IEA
GO:0022038	Process	Corpus callosum development	IEA
GO:0030424	Component	Axon	IEA
GO:0030424	Component	Axon	ISS
GO:0030425	Component	Dendrite	IEA
GO:0031103	Process	Axon regeneration	TAS	14664809
GO:0038023	Function	Signaling receptor activity	IBA
GO:0038023	Function	Signaling receptor activity	IDA	12694398
GO:0042995	Component	Cell projection	IEA
GO:0043005	Component	Neuron projection	ISS
GO:0043204	Component	Perikaryon	IEA
GO:0043204	Component	Perikaryon	ISS
GO:0045121	Component	Membrane raft	IEA
GO:0045121	Component	Membrane raft	ISS
GO:0051965	Process	Positive regulation of synapse assembly	IBA
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0098552	Component	Side of membrane	IEA

MIM	HGNC	e!Ensembl
610462	23053	ENSG00000186907

Q86UN3

Protein name

Reticulon-4 receptor-like 2 (Nogo receptor-like 3) (Nogo-66 receptor homolog 1) (Nogo-66 receptor-related protein 2) (NgR2)

Protein function

Cell surface receptor that plays a functionally redundant role in the inhibition of neurite outgrowth mediated by MAG (By similarity). Plays a functionally redundant role in postnatal brain development. Contributes to normal axon migration acros

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13855	LRR_8	60 → 117	Leucine rich repeat	Repeat
PF13855	LRR_8	106 → 167	Leucine rich repeat	Repeat
PF13855	LRR_8	160 → 215	Leucine rich repeat	Repeat
PF13855	LRR_8	203 → 262	Leucine rich repeat	Repeat

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in brain and liver. Expressed at lower levels in kidney, mammary gland, placenta, skeletal muscle, spleen and thyroid. {ECO:0000269|PubMed:12694398, ECO:0000269|PubMed:14664809}.

Sequence

MLPGLRRLLQAPASACLLLMLLALPLAAPSCPMLCTCYSSPPTVSCQANNFSSVPLSLPP
STQRLFLQNNLIRTLRPGTFGSNLLTLWLFSNNLSTIYPGTFRHLQALEELDLGDNRHLR
SLEPDTFQGLERLQSLHLYRCQLSSLPGNIFRGLVSLQYLYLQENSLLHLQDDLFADLAN
LSHLFLHGNRLRLLTEHVFRGLGSLDRLLLHGNRLQGVHRAAFRGLSRLTILYLFNNSLA
SLPGEALADLPSLEFLRLNANPWACDCRARPLWAWFQRARVSSSDVTCATPPERQGRDLR
ALREADFQACPPAAPTRPGSRARGNSSSNHLYGVAEAGAPPADPSTLYRDLPAEDSRGRQ
GGDAPTEDDYWGGYGGEDQRGEQMCPGAACQAPPDSRGPALSAGLPSPLLCLLLLVPHHL

Sequence length

420

Interactions

View interactions

	Reactome
			Post-translational modification: synthesis of GPI-anchored proteins

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
HODGKINS LYMPHOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (2)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Colorectal Carcinoma	Colorectal Cancer	BEFREE	26935861		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	37956856	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

RTN4RL2 (reticulon 4 receptor like 2)