IGFBP6 (insulin like growth factor binding protein 6)

Gene

• Entrez ID: 3489
• Gene name: Insulin like growth factor binding protein 6
• Gene symbol: IGFBP6
• Synonyms (NCBI Gene): IBP6
• Chromosome: 12
• Chromosome location: 12q13.13

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT2429972	hsa-miR-145	CLIP-seq
MIRT2429973	hsa-miR-1825	CLIP-seq
MIRT2429974	hsa-miR-199a-5p	CLIP-seq
MIRT2429975	hsa-miR-199b-5p	CLIP-seq
MIRT2429976	hsa-miR-3667-3p	CLIP-seq
MIRT2429977	hsa-miR-4326	CLIP-seq
MIRT2429978	hsa-miR-4716-5p	CLIP-seq
MIRT2437781	hsa-miR-3124-3p	CLIP-seq
MIRT2437782	hsa-miR-3591-3p	CLIP-seq
MIRT2550587	hsa-miR-129-5p	CLIP-seq
MIRT2550588	hsa-miR-1908	CLIP-seq
MIRT2550589	hsa-miR-2277-3p	CLIP-seq
MIRT2550590	hsa-miR-2861	CLIP-seq
MIRT2437781	hsa-miR-3124-3p	CLIP-seq
MIRT2550591	hsa-miR-3165	CLIP-seq
MIRT2550592	hsa-miR-3180	CLIP-seq
MIRT2550593	hsa-miR-3180-3p	CLIP-seq
MIRT2550594	hsa-miR-3184	CLIP-seq
MIRT2550595	hsa-miR-3196	CLIP-seq
MIRT2437782	hsa-miR-3591-3p	CLIP-seq
MIRT2550596	hsa-miR-3616-3p	CLIP-seq
MIRT2550597	hsa-miR-3675-5p	CLIP-seq
MIRT2550598	hsa-miR-423-5p	CLIP-seq
MIRT2550599	hsa-miR-4512	CLIP-seq
MIRT2550600	hsa-miR-4641	CLIP-seq
MIRT2550601	hsa-miR-4658	CLIP-seq
MIRT2550602	hsa-miR-4710	CLIP-seq
MIRT2550603	hsa-miR-4721	CLIP-seq
MIRT2550604	hsa-miR-4758-5p	CLIP-seq
MIRT2550605	hsa-miR-4765	CLIP-seq
MIRT2550606	hsa-miR-493	CLIP-seq
MIRT2550607	hsa-miR-653	CLIP-seq
MIRT2550608	hsa-miR-663	CLIP-seq
MIRT2550609	hsa-miR-744	CLIP-seq
MIRT2550588	hsa-miR-1908	CLIP-seq
MIRT2550589	hsa-miR-2277-3p	CLIP-seq
MIRT2550590	hsa-miR-2861	CLIP-seq
MIRT2437781	hsa-miR-3124-3p	CLIP-seq
MIRT2550591	hsa-miR-3165	CLIP-seq
MIRT2550592	hsa-miR-3180	CLIP-seq
MIRT2550593	hsa-miR-3180-3p	CLIP-seq
MIRT2550594	hsa-miR-3184	CLIP-seq
MIRT2550595	hsa-miR-3196	CLIP-seq
MIRT2437782	hsa-miR-3591-3p	CLIP-seq
MIRT2550596	hsa-miR-3616-3p	CLIP-seq
MIRT2550597	hsa-miR-3675-5p	CLIP-seq
MIRT2550598	hsa-miR-423-5p	CLIP-seq
MIRT2429977	hsa-miR-4326	CLIP-seq
MIRT2550600	hsa-miR-4641	CLIP-seq
MIRT2550602	hsa-miR-4710	CLIP-seq
MIRT2429978	hsa-miR-4716-5p	CLIP-seq
MIRT2550603	hsa-miR-4721	CLIP-seq
MIRT2550606	hsa-miR-493	CLIP-seq
MIRT2550608	hsa-miR-663	CLIP-seq
MIRT2550609	hsa-miR-744	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001968	Function	Fibronectin binding	IBA
GO:0005102	Function	Signaling receptor binding	TAS	24431302
GO:0005515	Function	Protein binding	IPI	24003225, 32296183
GO:0005520	Function	Insulin-like growth factor binding	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0007165	Process	Signal transduction	NAS	10087296
GO:0008285	Process	Negative regulation of cell population proliferation	TAS	7539002
GO:0016477	Process	Cell migration	IDA	24003225
GO:0019838	Function	Growth factor binding	IEA
GO:0031994	Function	Insulin-like growth factor I binding	IBA
GO:0031994	Function	Insulin-like growth factor I binding	IEA
GO:0031995	Function	Insulin-like growth factor II binding	IBA
GO:0031995	Function	Insulin-like growth factor II binding	IEA
GO:0031995	Function	Insulin-like growth factor II binding	IMP	15308688
GO:0032874	Process	Positive regulation of stress-activated MAPK cascade	IDA	24003225
GO:0042568	Component	Insulin-like growth factor binary complex	IMP	15308688
GO:0042802	Function	Identical protein binding	IPI	32296183
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	24003225
GO:0043567	Process	Regulation of insulin-like growth factor receptor signaling pathway	IBA
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	TAS	24431302

Other IDs

• MIM: 146735
• HGNC: 5475
• e!Ensembl: ENSG00000167779

Protein

• UniProt ID: P24592
• Protein name: Insulin-like growth factor-binding protein 6 (IBP-6) (IGF-binding protein 6) (IGFBP-6)
• Protein function: IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors. Activates t
• PDB: 1RMJ, 2JM2
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00086	Thyroglobulin_1	163 → 234	Thyroglobulin type-1 repeat	Domain

• Sequence:

  MTPHRLLPPLLLLLALLLAASPGGALARCPGCGQGVQAGCPGGCVEEEDGGSPAEGCAEA
  EGCLRREGQECGVYTPNCAPGLQCHPPKDDEAPLRALLLGRGRCLPARAPAVAEENPKES
  KPQAGTARPQDVNRRDQQRNPGTSTTPSQPNSAGVQDTEMGPCRRHLDSVLQQLQTEVYR
  GAQTLYVPNCDHRGFYRKRQCRSSQGQRRGPCWCVDRMGKSLPGSPDGNGSSSCPTGSSG
  

• Sequence length: 240

Pathways

Reactome:

Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Cervical cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONTACT DERMATITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, CONTACT	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	28588703		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	27644646		★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	38353026	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	27141097	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	30117676		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	38303428	Associate	★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone marrow diseases	Pubtator	34905501	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	18957410, 37950222, 38235137	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	39275851	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	21548981	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	22923130		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	15086466	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	21819702	Inhibit	★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	Pubtator	32037372	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	32037372	Inhibit	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	27644646		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	17519236, 23748022, 27644646, 29439316	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	37088808	Inhibit	★☆☆☆☆ Found in Text Mining only
Contact Dermatitis	Dermatitis	CTD_human_DG	25724174		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	15661050		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	28572803		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	26976474	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	35230239	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	39275851	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	37396184	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	7523316		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	23167388	Associate	★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	CTD_human_DG	21063030		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	CTD_human_DG	21063030		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fatty Liver	Fatty liver	Pubtator	33125080	Associate	★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	15337802		★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	28588703		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	30231881		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	35832140, 36193073	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	30231881		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	27650075, 30231881, 9454896		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	27650075, 34396926, 40428295	Associate	★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	33153489	Associate	★☆☆☆☆ Found in Text Mining only
hemangiopericytoma	Hemangiopericytoma	BEFREE	10468998		★☆☆☆☆ Found in Text Mining only
Hereditary hemochromatosis	Hereditary Hemochromatosis	BEFREE	24105601		★☆☆☆☆ Found in Text Mining only
Hypertension Pulmonary	Pulmonary hypertension	Pubtator	38353026	Associate	★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	10468998		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	28829625		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	7523316		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	22923130		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	15846301		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	15846301		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	26640143		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	17519236, 24003225, 30117676		★☆☆☆☆ Found in Text Mining only
Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	16443732		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	12125963		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	27644646, 35230239	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	27644646		★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	CTD_human_DG	18539642		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	10192430	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	20635349, 27623076		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10964166, 11874695, 15914054, 18982452, 21618524, 27644646, 28588703, 29039467, 30231881		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	11161966, 11874695, 23167388, 9563481		★☆☆☆☆ Found in Text Mining only
Niemann-Pick Disease, Type C	Niemann-Pick Disease	BEFREE	20635349		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	10980619		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	34371941	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	33282953	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	20452586		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	20452586	Stimulate	★☆☆☆☆ Found in Text Mining only
Proliferative vitreoretinopathy	Proliferative Vitreoretinopathy	BEFREE	24220750		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	15846301		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	15846301		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	15846301	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	15661050		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	LHGDN	15661050		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	CTD_human_DG	25070658		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	18997086		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	LHGDN	14710364, 17519236		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	24003225		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	24003225	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	28572803		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	32093803	Associate	★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	Pubtator	15967097	Associate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	31028944		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	26640143		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	37088808	Inhibit	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	36315566	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	28882129	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	39372720	Associate	★☆☆☆☆ Found in Text Mining only