Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	3486
Gene name	Insulin like growth factor binding protein 3
Gene symbol	IGFBP3
Synonyms (NCBI Gene)	BP-53IBP-3IBP3IGFBP-3
Chromosome	7
Chromosome location	7p12.3
Summary	This gene is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a thyroglobulin type-I domain. The protein forms a ternary complex with insulin-like growth factor acid-labile subunit (I

568

Show/Hide all (568)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019713	hsa-miR-375	Microarray	20215506
MIRT022363	hsa-miR-124-3p	Microarray	18668037
MIRT054206	hsa-miR-210-3p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	23028679
MIRT702750	hsa-miR-5580-3p	HITS-CLIP	23313552
MIRT702749	hsa-miR-4773	HITS-CLIP	23313552
MIRT702748	hsa-miR-371b-3p	HITS-CLIP	23313552
MIRT702747	hsa-miR-759	HITS-CLIP	23313552
MIRT702746	hsa-miR-1909-5p	HITS-CLIP	23313552
MIRT702745	hsa-miR-18b-3p	HITS-CLIP	23313552
MIRT702744	hsa-miR-7977	HITS-CLIP	23313552
MIRT702743	hsa-miR-3157-3p	HITS-CLIP	23313552
MIRT736697	hsa-miR-409-3p	Luciferase reporter assayWestern blottingqRT-PCR	33041662
MIRT737221	hsa-miR-133a-5p	Luciferase reporter assayWestern blottingImmunoprecipitaion (IP)Immunohistochemistry (IHC)qRT-PCRIn situ hybridization	32703944
MIRT702750	hsa-miR-5580-3p	HITS-CLIP	23313552
MIRT702749	hsa-miR-4773	HITS-CLIP	23313552
MIRT702748	hsa-miR-371b-3p	HITS-CLIP	23313552
MIRT702747	hsa-miR-759	HITS-CLIP	23313552
MIRT702746	hsa-miR-1909-5p	HITS-CLIP	23313552
MIRT702745	hsa-miR-18b-3p	HITS-CLIP	23313552
MIRT702744	hsa-miR-7977	HITS-CLIP	23313552
MIRT702743	hsa-miR-3157-3p	HITS-CLIP	23313552
MIRT054206	hsa-miR-210-3p	MicroarrayqRT-PCR	35816043
MIRT756284	hsa-miR-376a-3p	ELISA	37511378
MIRT756285	hsa-miR-26a-1-3p	ELISA	37511378
MIRT1062114	hsa-miR-1245	CLIP-seq
MIRT1062115	hsa-miR-21	CLIP-seq
MIRT1062116	hsa-miR-3606	CLIP-seq
MIRT1062117	hsa-miR-4756-3p	CLIP-seq
MIRT1062118	hsa-miR-520d-5p	CLIP-seq
MIRT1062119	hsa-miR-524-5p	CLIP-seq
MIRT1062120	hsa-miR-590-5p	CLIP-seq
MIRT1062121	hsa-miR-921	CLIP-seq
MIRT1549925	hsa-miR-124	CLIP-seq
MIRT1549926	hsa-miR-196a	CLIP-seq
MIRT1549927	hsa-miR-196b	CLIP-seq
MIRT1549928	hsa-miR-19a	CLIP-seq
MIRT1549929	hsa-miR-19b	CLIP-seq
MIRT1549930	hsa-miR-2113	CLIP-seq
MIRT1549931	hsa-miR-2682	CLIP-seq
MIRT1549932	hsa-miR-3143	CLIP-seq
MIRT1549933	hsa-miR-34a	CLIP-seq
MIRT1549934	hsa-miR-34c-5p	CLIP-seq
MIRT1549935	hsa-miR-3670	CLIP-seq
MIRT1549936	hsa-miR-3672	CLIP-seq
MIRT1549937	hsa-miR-3675-3p	CLIP-seq
MIRT1549938	hsa-miR-3714	CLIP-seq
MIRT1549939	hsa-miR-3910	CLIP-seq
MIRT1549940	hsa-miR-3921	CLIP-seq
MIRT1549941	hsa-miR-3927	CLIP-seq
MIRT1549942	hsa-miR-431	CLIP-seq
MIRT1549943	hsa-miR-4427	CLIP-seq
MIRT1549944	hsa-miR-449a	CLIP-seq
MIRT1549945	hsa-miR-449b	CLIP-seq
MIRT1549946	hsa-miR-449c	CLIP-seq
MIRT1549947	hsa-miR-4653-5p	CLIP-seq
MIRT1549948	hsa-miR-4680-3p	CLIP-seq
MIRT1549949	hsa-miR-4786-5p	CLIP-seq
MIRT1549950	hsa-miR-487a	CLIP-seq
MIRT1549951	hsa-miR-506	CLIP-seq
MIRT1549952	hsa-miR-526b	CLIP-seq
MIRT1549953	hsa-miR-543	CLIP-seq
MIRT1549954	hsa-miR-593	CLIP-seq
MIRT1549955	hsa-miR-769-5p	CLIP-seq
MIRT1549956	hsa-miR-940	CLIP-seq
MIRT1549925	hsa-miR-124	CLIP-seq
MIRT1549928	hsa-miR-19a	CLIP-seq
MIRT1549929	hsa-miR-19b	CLIP-seq
MIRT1549930	hsa-miR-2113	CLIP-seq
MIRT1549933	hsa-miR-34a	CLIP-seq
MIRT1549934	hsa-miR-34c-5p	CLIP-seq
MIRT1549938	hsa-miR-3714	CLIP-seq
MIRT1549939	hsa-miR-3910	CLIP-seq
MIRT1549944	hsa-miR-449a	CLIP-seq
MIRT1549945	hsa-miR-449b	CLIP-seq
MIRT1549951	hsa-miR-506	CLIP-seq
MIRT1549953	hsa-miR-543	CLIP-seq
MIRT1549925	hsa-miR-124	CLIP-seq
MIRT2246620	hsa-miR-138	CLIP-seq
MIRT1549928	hsa-miR-19a	CLIP-seq
MIRT1549929	hsa-miR-19b	CLIP-seq
MIRT1549930	hsa-miR-2113	CLIP-seq
MIRT2246621	hsa-miR-3137	CLIP-seq
MIRT2246622	hsa-miR-3189-3p	CLIP-seq
MIRT1549933	hsa-miR-34a	CLIP-seq
MIRT1549934	hsa-miR-34c-5p	CLIP-seq
MIRT2246623	hsa-miR-3614-5p	CLIP-seq
MIRT2246624	hsa-miR-3617	CLIP-seq
MIRT1549935	hsa-miR-3670	CLIP-seq
MIRT1549938	hsa-miR-3714	CLIP-seq
MIRT1549939	hsa-miR-3910	CLIP-seq
MIRT1549944	hsa-miR-449a	CLIP-seq
MIRT1549945	hsa-miR-449b	CLIP-seq
MIRT2246625	hsa-miR-4635	CLIP-seq
MIRT2246626	hsa-miR-4659a-3p	CLIP-seq
MIRT2246627	hsa-miR-4659b-3p	CLIP-seq
MIRT2246628	hsa-miR-4676-5p	CLIP-seq
MIRT2246629	hsa-miR-4709-3p	CLIP-seq
MIRT2246630	hsa-miR-4778-3p	CLIP-seq
MIRT2246631	hsa-miR-485-5p	CLIP-seq
MIRT1549951	hsa-miR-506	CLIP-seq
MIRT1549953	hsa-miR-543	CLIP-seq
MIRT2246632	hsa-miR-552	CLIP-seq
MIRT2246633	hsa-miR-563	CLIP-seq
MIRT2246634	hsa-miR-575	CLIP-seq
MIRT2246635	hsa-miR-641	CLIP-seq
MIRT1549935	hsa-miR-3670	CLIP-seq
MIRT2389302	hsa-miR-4677-3p	CLIP-seq
MIRT2389303	hsa-miR-665	CLIP-seq
MIRT2429817	hsa-miR-1179	CLIP-seq
MIRT2429818	hsa-miR-1184	CLIP-seq
MIRT2429819	hsa-miR-1193	CLIP-seq
MIRT2429820	hsa-miR-1205	CLIP-seq
MIRT2429821	hsa-miR-1227	CLIP-seq
MIRT1549925	hsa-miR-124	CLIP-seq
MIRT2429822	hsa-miR-1243	CLIP-seq
MIRT2429823	hsa-miR-1249	CLIP-seq
MIRT2429824	hsa-miR-1257	CLIP-seq
MIRT2429825	hsa-miR-1262	CLIP-seq
MIRT2429826	hsa-miR-1273c	CLIP-seq
MIRT2429827	hsa-miR-1283	CLIP-seq
MIRT2429828	hsa-miR-1305	CLIP-seq
MIRT2246620	hsa-miR-138	CLIP-seq
MIRT2429829	hsa-miR-140-3p	CLIP-seq
MIRT2429830	hsa-miR-142-5p	CLIP-seq
MIRT2429831	hsa-miR-143	CLIP-seq
MIRT2429832	hsa-miR-186	CLIP-seq
MIRT2429833	hsa-miR-1914	CLIP-seq
MIRT2429834	hsa-miR-197	CLIP-seq
MIRT2429835	hsa-miR-199a-5p	CLIP-seq
MIRT2429836	hsa-miR-199b-5p	CLIP-seq
MIRT1549928	hsa-miR-19a	CLIP-seq
MIRT1549929	hsa-miR-19b	CLIP-seq
MIRT1549930	hsa-miR-2113	CLIP-seq
MIRT2429837	hsa-miR-2114	CLIP-seq
MIRT2429838	hsa-miR-2117	CLIP-seq
MIRT2429839	hsa-miR-216b	CLIP-seq
MIRT2429840	hsa-miR-218	CLIP-seq
MIRT2429841	hsa-miR-219-2-3p	CLIP-seq
MIRT2429842	hsa-miR-2355-5p	CLIP-seq
MIRT2429843	hsa-miR-2964a-5p	CLIP-seq
MIRT2429844	hsa-miR-300	CLIP-seq
MIRT2429845	hsa-miR-3065-5p	CLIP-seq
MIRT2429846	hsa-miR-3117-3p	CLIP-seq
MIRT2429847	hsa-miR-3126-5p	CLIP-seq
MIRT2429848	hsa-miR-3133	CLIP-seq
MIRT2246621	hsa-miR-3137	CLIP-seq
MIRT1549932	hsa-miR-3143	CLIP-seq
MIRT2429849	hsa-miR-3145-3p	CLIP-seq
MIRT2429850	hsa-miR-3152-5p	CLIP-seq
MIRT2429851	hsa-miR-3158-5p	CLIP-seq
MIRT2429852	hsa-miR-3159	CLIP-seq
MIRT2429853	hsa-miR-3169	CLIP-seq
MIRT2429854	hsa-miR-3173-3p	CLIP-seq
MIRT2246622	hsa-miR-3189-3p	CLIP-seq
MIRT2429855	hsa-miR-320a	CLIP-seq
MIRT2429856	hsa-miR-320b	CLIP-seq
MIRT2429857	hsa-miR-320c	CLIP-seq
MIRT2429858	hsa-miR-320d	CLIP-seq
MIRT2429859	hsa-miR-323b-3p	CLIP-seq
MIRT2429860	hsa-miR-325	CLIP-seq
MIRT2429861	hsa-miR-337-3p	CLIP-seq
MIRT2429862	hsa-miR-340	CLIP-seq
MIRT1549933	hsa-miR-34a	CLIP-seq
MIRT1549934	hsa-miR-34c-5p	CLIP-seq
MIRT2429863	hsa-miR-3545-3p	CLIP-seq
MIRT2429864	hsa-miR-3609	CLIP-seq
MIRT2429865	hsa-miR-3613-3p	CLIP-seq
MIRT2429866	hsa-miR-3613-5p	CLIP-seq
MIRT2246623	hsa-miR-3614-5p	CLIP-seq
MIRT2246624	hsa-miR-3617	CLIP-seq
MIRT2429867	hsa-miR-3647-3p	CLIP-seq
MIRT2429868	hsa-miR-3654	CLIP-seq
MIRT2429869	hsa-miR-3657	CLIP-seq
MIRT2429870	hsa-miR-3667-3p	CLIP-seq
MIRT1549935	hsa-miR-3670	CLIP-seq
MIRT1549937	hsa-miR-3675-3p	CLIP-seq
MIRT2429871	hsa-miR-3679-3p	CLIP-seq
MIRT2429872	hsa-miR-3685	CLIP-seq
MIRT2429873	hsa-miR-3690	CLIP-seq
MIRT1549938	hsa-miR-3714	CLIP-seq
MIRT2429874	hsa-miR-371-5p	CLIP-seq
MIRT2429875	hsa-miR-371b-5p	CLIP-seq
MIRT2429876	hsa-miR-376c	CLIP-seq
MIRT2429877	hsa-miR-381	CLIP-seq
MIRT2429878	hsa-miR-384	CLIP-seq
MIRT1549939	hsa-miR-3910	CLIP-seq
MIRT1549940	hsa-miR-3921	CLIP-seq
MIRT2429879	hsa-miR-3978	CLIP-seq
MIRT2429880	hsa-miR-421	CLIP-seq
MIRT2429881	hsa-miR-4254	CLIP-seq
MIRT2429882	hsa-miR-4260	CLIP-seq
MIRT2429883	hsa-miR-4263	CLIP-seq
MIRT2429884	hsa-miR-4273	CLIP-seq
MIRT2429885	hsa-miR-4277	CLIP-seq
MIRT2429886	hsa-miR-4283	CLIP-seq
MIRT2429887	hsa-miR-4289	CLIP-seq
MIRT2429888	hsa-miR-4419a	CLIP-seq
MIRT2429889	hsa-miR-4422	CLIP-seq
MIRT2429890	hsa-miR-4425	CLIP-seq
MIRT1549943	hsa-miR-4427	CLIP-seq
MIRT2429891	hsa-miR-4428	CLIP-seq
MIRT2429892	hsa-miR-4429	CLIP-seq
MIRT2429893	hsa-miR-4437	CLIP-seq
MIRT2429894	hsa-miR-4446-5p	CLIP-seq
MIRT2429895	hsa-miR-4447	CLIP-seq
MIRT2429896	hsa-miR-4472	CLIP-seq
MIRT2429897	hsa-miR-4476	CLIP-seq
MIRT2429898	hsa-miR-448	CLIP-seq
MIRT2429899	hsa-miR-4481	CLIP-seq
MIRT2429900	hsa-miR-4489	CLIP-seq
MIRT2429901	hsa-miR-4491	CLIP-seq
MIRT1549944	hsa-miR-449a	CLIP-seq
MIRT1549945	hsa-miR-449b	CLIP-seq
MIRT2429902	hsa-miR-450b-3p	CLIP-seq
MIRT2429903	hsa-miR-4510	CLIP-seq
MIRT2429904	hsa-miR-4521	CLIP-seq
MIRT2429905	hsa-miR-4522	CLIP-seq
MIRT2429906	hsa-miR-455-5p	CLIP-seq
MIRT2246625	hsa-miR-4635	CLIP-seq
MIRT2429907	hsa-miR-4639-5p	CLIP-seq
MIRT1549947	hsa-miR-4653-5p	CLIP-seq
MIRT2429908	hsa-miR-4655-5p	CLIP-seq
MIRT2429909	hsa-miR-4657	CLIP-seq
MIRT2246626	hsa-miR-4659a-3p	CLIP-seq
MIRT2246627	hsa-miR-4659b-3p	CLIP-seq
MIRT2429910	hsa-miR-4666-3p	CLIP-seq
MIRT2429911	hsa-miR-4669	CLIP-seq
MIRT2429912	hsa-miR-4671-5p	CLIP-seq
MIRT2429913	hsa-miR-4674	CLIP-seq
MIRT2246628	hsa-miR-4676-5p	CLIP-seq
MIRT2389302	hsa-miR-4677-3p	CLIP-seq
MIRT1549948	hsa-miR-4680-3p	CLIP-seq
MIRT2429914	hsa-miR-4684-5p	CLIP-seq
MIRT2429915	hsa-miR-4691-5p	CLIP-seq
MIRT2429916	hsa-miR-4696	CLIP-seq
MIRT2429917	hsa-miR-4701-3p	CLIP-seq
MIRT2246629	hsa-miR-4709-3p	CLIP-seq
MIRT2429918	hsa-miR-4710	CLIP-seq
MIRT2429919	hsa-miR-4712-3p	CLIP-seq
MIRT2429920	hsa-miR-4713-3p	CLIP-seq
MIRT2429921	hsa-miR-4745-5p	CLIP-seq
MIRT2429922	hsa-miR-4759	CLIP-seq
MIRT2429923	hsa-miR-4762-3p	CLIP-seq
MIRT2429924	hsa-miR-4770	CLIP-seq
MIRT2429925	hsa-miR-4774-3p	CLIP-seq
MIRT2246630	hsa-miR-4778-3p	CLIP-seq
MIRT2429926	hsa-miR-4781-3p	CLIP-seq
MIRT1549949	hsa-miR-4786-5p	CLIP-seq
MIRT2429927	hsa-miR-4792	CLIP-seq
MIRT2429928	hsa-miR-4799-5p	CLIP-seq
MIRT2246631	hsa-miR-485-5p	CLIP-seq
MIRT1549950	hsa-miR-487a	CLIP-seq
MIRT2429929	hsa-miR-495	CLIP-seq
MIRT2429930	hsa-miR-498	CLIP-seq
MIRT1549951	hsa-miR-506	CLIP-seq
MIRT2429931	hsa-miR-513c	CLIP-seq
MIRT2429932	hsa-miR-514b-5p	CLIP-seq
MIRT2429933	hsa-miR-515-5p	CLIP-seq
MIRT2429934	hsa-miR-516a-5p	CLIP-seq
MIRT1549953	hsa-miR-543	CLIP-seq
MIRT2429935	hsa-miR-544	CLIP-seq
MIRT2429936	hsa-miR-548ac	CLIP-seq
MIRT2429937	hsa-miR-548ah	CLIP-seq
MIRT2429938	hsa-miR-548d-3p	CLIP-seq
MIRT2429939	hsa-miR-548m	CLIP-seq
MIRT2429940	hsa-miR-548z	CLIP-seq
MIRT2429941	hsa-miR-550b	CLIP-seq
MIRT2246632	hsa-miR-552	CLIP-seq
MIRT2246633	hsa-miR-563	CLIP-seq
MIRT2429942	hsa-miR-568	CLIP-seq
MIRT2246634	hsa-miR-575	CLIP-seq
MIRT2429943	hsa-miR-576-5p	CLIP-seq
MIRT1549954	hsa-miR-593	CLIP-seq
MIRT2429944	hsa-miR-607	CLIP-seq
MIRT2429945	hsa-miR-628-3p	CLIP-seq
MIRT2429946	hsa-miR-628-5p	CLIP-seq
MIRT2429947	hsa-miR-629	CLIP-seq
MIRT2246635	hsa-miR-641	CLIP-seq
MIRT2429948	hsa-miR-653	CLIP-seq
MIRT2389303	hsa-miR-665	CLIP-seq
MIRT2429949	hsa-miR-769-3p	CLIP-seq
MIRT1549955	hsa-miR-769-5p	CLIP-seq
MIRT2429950	hsa-miR-875-3p	CLIP-seq
MIRT2429951	hsa-miR-885-5p	CLIP-seq
MIRT2429952	hsa-miR-933	CLIP-seq
MIRT2429953	hsa-miR-942	CLIP-seq
MIRT1549953	hsa-miR-543	CLIP-seq
MIRT2550525	hsa-miR-103a	CLIP-seq
MIRT2550526	hsa-miR-107	CLIP-seq
MIRT2429818	hsa-miR-1184	CLIP-seq
MIRT2429819	hsa-miR-1193	CLIP-seq
MIRT2550527	hsa-miR-1200	CLIP-seq
MIRT2550528	hsa-miR-1202	CLIP-seq
MIRT2429820	hsa-miR-1205	CLIP-seq
MIRT2550529	hsa-miR-1238	CLIP-seq
MIRT2550530	hsa-miR-1248	CLIP-seq
MIRT2550531	hsa-miR-125a-5p	CLIP-seq
MIRT2550532	hsa-miR-125b	CLIP-seq
MIRT2429825	hsa-miR-1262	CLIP-seq
MIRT2550533	hsa-miR-1268	CLIP-seq
MIRT2550534	hsa-miR-1268b	CLIP-seq
MIRT2550535	hsa-miR-1285	CLIP-seq
MIRT2429828	hsa-miR-1305	CLIP-seq
MIRT2550536	hsa-miR-1343	CLIP-seq
MIRT2429829	hsa-miR-140-3p	CLIP-seq
MIRT2429831	hsa-miR-143	CLIP-seq
MIRT2550537	hsa-miR-1470	CLIP-seq
MIRT2429833	hsa-miR-1914	CLIP-seq
MIRT2429835	hsa-miR-199a-5p	CLIP-seq
MIRT2429836	hsa-miR-199b-5p	CLIP-seq
MIRT2429838	hsa-miR-2117	CLIP-seq
MIRT2550538	hsa-miR-214	CLIP-seq
MIRT2429839	hsa-miR-216b	CLIP-seq
MIRT2429840	hsa-miR-218	CLIP-seq
MIRT2550539	hsa-miR-2278	CLIP-seq
MIRT2429842	hsa-miR-2355-5p	CLIP-seq
MIRT2550540	hsa-miR-2861	CLIP-seq
MIRT2429843	hsa-miR-2964a-5p	CLIP-seq
MIRT2429844	hsa-miR-300	CLIP-seq
MIRT2429845	hsa-miR-3065-5p	CLIP-seq
MIRT2550541	hsa-miR-3124-3p	CLIP-seq
MIRT2550542	hsa-miR-3140-5p	CLIP-seq
MIRT1549932	hsa-miR-3143	CLIP-seq
MIRT2429849	hsa-miR-3145-3p	CLIP-seq
MIRT2429851	hsa-miR-3158-5p	CLIP-seq
MIRT2429852	hsa-miR-3159	CLIP-seq
MIRT2429854	hsa-miR-3173-3p	CLIP-seq
MIRT2550543	hsa-miR-3187-5p	CLIP-seq
MIRT2429860	hsa-miR-325	CLIP-seq
MIRT2550544	hsa-miR-326	CLIP-seq
MIRT2550545	hsa-miR-330-5p	CLIP-seq
MIRT2429861	hsa-miR-337-3p	CLIP-seq
MIRT2550546	hsa-miR-339-5p	CLIP-seq
MIRT2429866	hsa-miR-3613-5p	CLIP-seq
MIRT2550547	hsa-miR-3619-5p	CLIP-seq
MIRT2429867	hsa-miR-3647-3p	CLIP-seq
MIRT2429869	hsa-miR-3657	CLIP-seq
MIRT2429870	hsa-miR-3667-3p	CLIP-seq
MIRT1549935	hsa-miR-3670	CLIP-seq
MIRT1549937	hsa-miR-3675-3p	CLIP-seq
MIRT2429872	hsa-miR-3685	CLIP-seq
MIRT2429873	hsa-miR-3690	CLIP-seq
MIRT2429876	hsa-miR-376c	CLIP-seq
MIRT2550548	hsa-miR-378g	CLIP-seq
MIRT2429877	hsa-miR-381	CLIP-seq
MIRT2429878	hsa-miR-384	CLIP-seq
MIRT2550549	hsa-miR-3940-5p	CLIP-seq
MIRT2550550	hsa-miR-3972	CLIP-seq
MIRT2429880	hsa-miR-421	CLIP-seq
MIRT2429881	hsa-miR-4254	CLIP-seq
MIRT2429882	hsa-miR-4260	CLIP-seq
MIRT2550551	hsa-miR-4264	CLIP-seq
MIRT2429884	hsa-miR-4273	CLIP-seq
MIRT2429886	hsa-miR-4283	CLIP-seq
MIRT2550552	hsa-miR-4287	CLIP-seq
MIRT2429887	hsa-miR-4289	CLIP-seq
MIRT2550553	hsa-miR-4293	CLIP-seq
MIRT2550554	hsa-miR-4319	CLIP-seq
MIRT2550555	hsa-miR-4421	CLIP-seq
MIRT2429890	hsa-miR-4425	CLIP-seq
MIRT2429891	hsa-miR-4428	CLIP-seq
MIRT2550556	hsa-miR-4436b-3p	CLIP-seq
MIRT2429893	hsa-miR-4437	CLIP-seq
MIRT2429895	hsa-miR-4447	CLIP-seq
MIRT2550557	hsa-miR-4448	CLIP-seq
MIRT2550558	hsa-miR-4469	CLIP-seq
MIRT2429896	hsa-miR-4472	CLIP-seq
MIRT2429899	hsa-miR-4481	CLIP-seq
MIRT2550559	hsa-miR-4486	CLIP-seq
MIRT2429900	hsa-miR-4489	CLIP-seq
MIRT2550560	hsa-miR-4497	CLIP-seq
MIRT2550561	hsa-miR-4507	CLIP-seq
MIRT2429902	hsa-miR-450b-3p	CLIP-seq
MIRT2429904	hsa-miR-4521	CLIP-seq
MIRT2429905	hsa-miR-4522	CLIP-seq
MIRT2550562	hsa-miR-4527	CLIP-seq
MIRT2429906	hsa-miR-455-5p	CLIP-seq
MIRT2429907	hsa-miR-4639-5p	CLIP-seq
MIRT2550563	hsa-miR-4640-5p	CLIP-seq
MIRT2429908	hsa-miR-4655-5p	CLIP-seq
MIRT2429910	hsa-miR-4666-3p	CLIP-seq
MIRT2550564	hsa-miR-4667-3p	CLIP-seq
MIRT2429911	hsa-miR-4669	CLIP-seq
MIRT2429913	hsa-miR-4674	CLIP-seq
MIRT2389302	hsa-miR-4677-3p	CLIP-seq
MIRT2429914	hsa-miR-4684-5p	CLIP-seq
MIRT2550565	hsa-miR-4685-3p	CLIP-seq
MIRT2550566	hsa-miR-4690-3p	CLIP-seq
MIRT2429915	hsa-miR-4691-5p	CLIP-seq
MIRT2550567	hsa-miR-4699-5p	CLIP-seq
MIRT2429917	hsa-miR-4701-3p	CLIP-seq
MIRT2550568	hsa-miR-4701-5p	CLIP-seq
MIRT2550569	hsa-miR-4704-3p	CLIP-seq
MIRT2246629	hsa-miR-4709-3p	CLIP-seq
MIRT2429919	hsa-miR-4712-3p	CLIP-seq
MIRT2550570	hsa-miR-4726-5p	CLIP-seq
MIRT2550571	hsa-miR-4732-3p	CLIP-seq
MIRT2429921	hsa-miR-4745-5p	CLIP-seq
MIRT2550572	hsa-miR-4757-5p	CLIP-seq
MIRT2429923	hsa-miR-4762-3p	CLIP-seq
MIRT2429924	hsa-miR-4770	CLIP-seq
MIRT2550573	hsa-miR-4776-3p	CLIP-seq
MIRT2550574	hsa-miR-4779	CLIP-seq
MIRT2429926	hsa-miR-4781-3p	CLIP-seq
MIRT1549949	hsa-miR-4786-5p	CLIP-seq
MIRT2550575	hsa-miR-4793-5p	CLIP-seq
MIRT1549950	hsa-miR-487a	CLIP-seq
MIRT2429929	hsa-miR-495	CLIP-seq
MIRT2429930	hsa-miR-498	CLIP-seq
MIRT2429934	hsa-miR-516a-5p	CLIP-seq
MIRT1549953	hsa-miR-543	CLIP-seq
MIRT2550576	hsa-miR-545	CLIP-seq
MIRT2429939	hsa-miR-548m	CLIP-seq
MIRT2550577	hsa-miR-548p	CLIP-seq
MIRT2429941	hsa-miR-550b	CLIP-seq
MIRT2429942	hsa-miR-568	CLIP-seq
MIRT2550578	hsa-miR-585	CLIP-seq
MIRT2550579	hsa-miR-588	CLIP-seq
MIRT1549954	hsa-miR-593	CLIP-seq
MIRT2550580	hsa-miR-612	CLIP-seq
MIRT2429945	hsa-miR-628-3p	CLIP-seq
MIRT2429947	hsa-miR-629	CLIP-seq
MIRT2550581	hsa-miR-635	CLIP-seq
MIRT2389303	hsa-miR-665	CLIP-seq
MIRT2550582	hsa-miR-670	CLIP-seq
MIRT2550583	hsa-miR-761	CLIP-seq
MIRT2429949	hsa-miR-769-3p	CLIP-seq
MIRT1549955	hsa-miR-769-5p	CLIP-seq
MIRT2550584	hsa-miR-873	CLIP-seq
MIRT2429952	hsa-miR-933	CLIP-seq
MIRT2550525	hsa-miR-103a	CLIP-seq
MIRT2550526	hsa-miR-107	CLIP-seq
MIRT2429818	hsa-miR-1184	CLIP-seq
MIRT2429819	hsa-miR-1193	CLIP-seq
MIRT2550527	hsa-miR-1200	CLIP-seq
MIRT2550528	hsa-miR-1202	CLIP-seq
MIRT2429820	hsa-miR-1205	CLIP-seq
MIRT2550529	hsa-miR-1238	CLIP-seq
MIRT2550530	hsa-miR-1248	CLIP-seq
MIRT2550531	hsa-miR-125a-5p	CLIP-seq
MIRT2550532	hsa-miR-125b	CLIP-seq
MIRT2429825	hsa-miR-1262	CLIP-seq
MIRT2550533	hsa-miR-1268	CLIP-seq
MIRT2550534	hsa-miR-1268b	CLIP-seq
MIRT2550535	hsa-miR-1285	CLIP-seq
MIRT2429828	hsa-miR-1305	CLIP-seq
MIRT2550536	hsa-miR-1343	CLIP-seq
MIRT2429829	hsa-miR-140-3p	CLIP-seq
MIRT2429831	hsa-miR-143	CLIP-seq
MIRT2550537	hsa-miR-1470	CLIP-seq
MIRT2429833	hsa-miR-1914	CLIP-seq
MIRT2429835	hsa-miR-199a-5p	CLIP-seq
MIRT2429836	hsa-miR-199b-5p	CLIP-seq
MIRT2429838	hsa-miR-2117	CLIP-seq
MIRT2550538	hsa-miR-214	CLIP-seq
MIRT2429839	hsa-miR-216b	CLIP-seq
MIRT2429840	hsa-miR-218	CLIP-seq
MIRT2550539	hsa-miR-2278	CLIP-seq
MIRT2429842	hsa-miR-2355-5p	CLIP-seq
MIRT2550540	hsa-miR-2861	CLIP-seq
MIRT2429843	hsa-miR-2964a-5p	CLIP-seq
MIRT2429845	hsa-miR-3065-5p	CLIP-seq
MIRT2550541	hsa-miR-3124-3p	CLIP-seq
MIRT2550542	hsa-miR-3140-5p	CLIP-seq
MIRT1549932	hsa-miR-3143	CLIP-seq
MIRT2429849	hsa-miR-3145-3p	CLIP-seq
MIRT2429851	hsa-miR-3158-5p	CLIP-seq
MIRT2429852	hsa-miR-3159	CLIP-seq
MIRT2429854	hsa-miR-3173-3p	CLIP-seq
MIRT2550543	hsa-miR-3187-5p	CLIP-seq
MIRT2429855	hsa-miR-320a	CLIP-seq
MIRT2429856	hsa-miR-320b	CLIP-seq
MIRT2429857	hsa-miR-320c	CLIP-seq
MIRT2429858	hsa-miR-320d	CLIP-seq
MIRT2429860	hsa-miR-325	CLIP-seq
MIRT2550544	hsa-miR-326	CLIP-seq
MIRT2550545	hsa-miR-330-5p	CLIP-seq
MIRT2429861	hsa-miR-337-3p	CLIP-seq
MIRT2550546	hsa-miR-339-5p	CLIP-seq
MIRT2550547	hsa-miR-3619-5p	CLIP-seq
MIRT2429867	hsa-miR-3647-3p	CLIP-seq
MIRT2429869	hsa-miR-3657	CLIP-seq
MIRT2429870	hsa-miR-3667-3p	CLIP-seq
MIRT1549935	hsa-miR-3670	CLIP-seq
MIRT1549937	hsa-miR-3675-3p	CLIP-seq
MIRT2429872	hsa-miR-3685	CLIP-seq
MIRT2429873	hsa-miR-3690	CLIP-seq
MIRT2429876	hsa-miR-376c	CLIP-seq
MIRT2550548	hsa-miR-378g	CLIP-seq
MIRT2429878	hsa-miR-384	CLIP-seq
MIRT2550549	hsa-miR-3940-5p	CLIP-seq
MIRT2550550	hsa-miR-3972	CLIP-seq
MIRT2429880	hsa-miR-421	CLIP-seq
MIRT2429881	hsa-miR-4254	CLIP-seq
MIRT2550551	hsa-miR-4264	CLIP-seq
MIRT2429884	hsa-miR-4273	CLIP-seq
MIRT2550552	hsa-miR-4287	CLIP-seq
MIRT2429887	hsa-miR-4289	CLIP-seq
MIRT2550553	hsa-miR-4293	CLIP-seq
MIRT2550554	hsa-miR-4319	CLIP-seq
MIRT2550555	hsa-miR-4421	CLIP-seq
MIRT2429890	hsa-miR-4425	CLIP-seq
MIRT2429891	hsa-miR-4428	CLIP-seq
MIRT2429892	hsa-miR-4429	CLIP-seq
MIRT2550556	hsa-miR-4436b-3p	CLIP-seq
MIRT2429893	hsa-miR-4437	CLIP-seq
MIRT2429895	hsa-miR-4447	CLIP-seq
MIRT2550557	hsa-miR-4448	CLIP-seq
MIRT2550558	hsa-miR-4469	CLIP-seq
MIRT2429896	hsa-miR-4472	CLIP-seq
MIRT2429899	hsa-miR-4481	CLIP-seq
MIRT2550559	hsa-miR-4486	CLIP-seq
MIRT2550560	hsa-miR-4497	CLIP-seq
MIRT2550561	hsa-miR-4507	CLIP-seq
MIRT2429902	hsa-miR-450b-3p	CLIP-seq
MIRT2429904	hsa-miR-4521	CLIP-seq
MIRT2429905	hsa-miR-4522	CLIP-seq
MIRT2550562	hsa-miR-4527	CLIP-seq
MIRT2429906	hsa-miR-455-5p	CLIP-seq
MIRT2429907	hsa-miR-4639-5p	CLIP-seq
MIRT2550563	hsa-miR-4640-5p	CLIP-seq
MIRT2429908	hsa-miR-4655-5p	CLIP-seq
MIRT2550564	hsa-miR-4667-3p	CLIP-seq
MIRT2429911	hsa-miR-4669	CLIP-seq
MIRT2429913	hsa-miR-4674	CLIP-seq
MIRT2389302	hsa-miR-4677-3p	CLIP-seq
MIRT2429914	hsa-miR-4684-5p	CLIP-seq
MIRT2550565	hsa-miR-4685-3p	CLIP-seq
MIRT2550566	hsa-miR-4690-3p	CLIP-seq
MIRT2429915	hsa-miR-4691-5p	CLIP-seq
MIRT2550567	hsa-miR-4699-5p	CLIP-seq
MIRT2429917	hsa-miR-4701-3p	CLIP-seq
MIRT2550568	hsa-miR-4701-5p	CLIP-seq
MIRT2550569	hsa-miR-4704-3p	CLIP-seq
MIRT2246629	hsa-miR-4709-3p	CLIP-seq
MIRT2429919	hsa-miR-4712-3p	CLIP-seq
MIRT2550570	hsa-miR-4726-5p	CLIP-seq
MIRT2550571	hsa-miR-4732-3p	CLIP-seq
MIRT2429921	hsa-miR-4745-5p	CLIP-seq
MIRT2550572	hsa-miR-4757-5p	CLIP-seq
MIRT2429923	hsa-miR-4762-3p	CLIP-seq
MIRT2429924	hsa-miR-4770	CLIP-seq
MIRT2550573	hsa-miR-4776-3p	CLIP-seq
MIRT2550574	hsa-miR-4779	CLIP-seq
MIRT1549949	hsa-miR-4786-5p	CLIP-seq
MIRT2550575	hsa-miR-4793-5p	CLIP-seq
MIRT1549950	hsa-miR-487a	CLIP-seq
MIRT2429929	hsa-miR-495	CLIP-seq
MIRT2429930	hsa-miR-498	CLIP-seq
MIRT2429934	hsa-miR-516a-5p	CLIP-seq
MIRT1549953	hsa-miR-543	CLIP-seq
MIRT2550576	hsa-miR-545	CLIP-seq
MIRT2429939	hsa-miR-548m	CLIP-seq
MIRT2550577	hsa-miR-548p	CLIP-seq
MIRT2550578	hsa-miR-585	CLIP-seq
MIRT2550579	hsa-miR-588	CLIP-seq
MIRT1549954	hsa-miR-593	CLIP-seq
MIRT2550580	hsa-miR-612	CLIP-seq
MIRT2429945	hsa-miR-628-3p	CLIP-seq
MIRT2429947	hsa-miR-629	CLIP-seq
MIRT2550581	hsa-miR-635	CLIP-seq
MIRT2389303	hsa-miR-665	CLIP-seq
MIRT2550582	hsa-miR-670	CLIP-seq
MIRT2550583	hsa-miR-761	CLIP-seq
MIRT2429949	hsa-miR-769-3p	CLIP-seq
MIRT1549955	hsa-miR-769-5p	CLIP-seq
MIRT2550584	hsa-miR-873	CLIP-seq
MIRT2429952	hsa-miR-933	CLIP-seq

Show/Hide all (15)

Transcription factor	Regulation	Reference
AR	Unknown	23859805
CDX2	Repression	17297462
DLX5	Unknown	17278996
DNMT3A	Repression	19070387
EP300	Activation	12200149
FLI1	Repression	15282325
HDAC1	Activation	12200149
HOXC6	Repression	15637592
MECP2	Repression	17278996
NCOR1	Repression	23098689
SP1	Activation	12200149
SP3	Activation	12200149
TP53	Activation	10101800
VDR	Repression	23770368
VDR	Unknown	14963110

Show/Hide all (44)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	IEA
GO:0001558	Process	Regulation of cell growth	IEA
GO:0001649	Process	Osteoblast differentiation	IEA
GO:0001933	Process	Negative regulation of protein phosphorylation	IDA	17591901
GO:0001968	Function	Fibronectin binding	IBA
GO:0001968	Function	Fibronectin binding	IEA
GO:0005515	Function	Protein binding	IPI	9388210, 14561895, 20353938, 23178489, 26216267, 30184438, 32814053
GO:0005520	Function	Insulin-like growth factor binding	IEA
GO:0005520	Function	Insulin-like growth factor binding	NAS	12599210
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	NAS	14718574
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	17119061
GO:0005615	Component	Extracellular space	IEA
GO:0005634	Component	Nucleus	IDA	17434920
GO:0005634	Component	Nucleus	IEA
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0006468	Process	Protein phosphorylation	IDA	17434920
GO:0006915	Process	Apoptotic process	IEA
GO:0008160	Function	Protein tyrosine phosphatase activator activity	IDA	11940579
GO:0008285	Process	Negative regulation of cell population proliferation	IGI	19258508
GO:0009968	Process	Negative regulation of signal transduction	NAS	11940579
GO:0010906	Process	Regulation of glucose metabolic process	IEA
GO:0014912	Process	Negative regulation of smooth muscle cell migration	IDA	10766744
GO:0014912	Process	Negative regulation of smooth muscle cell migration	IEA
GO:0016942	Component	Insulin-like growth factor binding protein complex	IC	10766744
GO:0019838	Function	Growth factor binding	IEA
GO:0031994	Function	Insulin-like growth factor I binding	IBA
GO:0031994	Function	Insulin-like growth factor I binding	IEA
GO:0031994	Function	Insulin-like growth factor I binding	IPI	10766744
GO:0031995	Function	Insulin-like growth factor II binding	IBA
GO:0040008	Process	Regulation of growth	IEA
GO:0042567	Component	Insulin-like growth factor ternary complex	IDA	9497324
GO:0042567	Component	Insulin-like growth factor ternary complex	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IMP	11971816
GO:0043410	Process	Positive regulation of MAPK cascade	IEA
GO:0043567	Process	Regulation of insulin-like growth factor receptor signaling pathway	IBA
GO:0043568	Process	Positive regulation of insulin-like growth factor receptor signaling pathway	IEA
GO:0044342	Process	Type B pancreatic cell proliferation	IEA
GO:0045663	Process	Positive regulation of myoblast differentiation	IDA	12599210
GO:0046872	Function	Metal ion binding	NAS	14576163
GO:0048662	Process	Negative regulation of smooth muscle cell proliferation	IDA	10766744
GO:0048662	Process	Negative regulation of smooth muscle cell proliferation	IEA

MIM	HGNC	e!Ensembl
146732	5472	ENSG00000146674

P17936

Protein name

Insulin-like growth factor-binding protein 3 (IBP-3) (IGF-binding protein 3) (IGFBP-3)

Protein function

Multifunctional protein that plays a critical role in regulating the availability of IGFs such as IGF1 and IGF2 to their receptors and thereby regulates IGF-mediated cellular processes including proliferation, differentiation, and apoptosis in a

PDB

7WRQ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00219	IGFBP	40 → 94	Insulin-like growth factor binding protein	Domain
PF00086	Thyroglobulin_1	213 → 285	Thyroglobulin type-1 repeat	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed by most tissues. Present in plasma.

Sequence

MQRARPTLWAAALTLLVLLRGPPVARAGASSAGLGPVVRCEPCDARALAQCAPPPAVCAE
LVREPGCGCCLTCALSEGQPCGIYTERCGSGLRCQPSPDEARPLQALLDGRGLCVNASAV
SRLRAYLLPAPPAPGNASESEEDRSAGSVESPSVSSTHRVSDPKFHPLHSKIIIIKKGHA
KDSQRYKVDYESQSTDTQNFSSESKRETEYGPCRREMEDTLNHLKFLNVLSPRGVHIPNC
DKKGFYKKKQCRPSKGRKRGFCWCVDKYGQPLPGYTTKGKEDVHCYSMQSK

Sequence length

291

Interactions

View interactions

	KEGG		Reactome
	p53 signaling pathway Cellular senescence Growth hormone synthesis, secretion and action Transcriptional misregulation in cancer		Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs) TP53 Regulates Transcription of Death Receptors and Ligands Post-translational protein phosphorylation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (21)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMERS DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, RHEUMATOID	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISTIC DISORDER	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BONNEVIE-ULLRICH SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, TRANSITIONAL CELL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, INSULIN-DEPENDENT	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYNOVITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TURNER SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY BLADDER NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENOUS THROMBOEMBOLISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (400)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Achondroplasia	Achondroplasia	Pubtator	27370225	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Acromegaly	Acromegaly	BEFREE	20920870, 25385818, 25552351, 30290787, 9024241		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acromegaly	Acromegaly	Pubtator	27070751	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Acromegaly	Acromegaly	Pubtator	30290787	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ACTH-Secreting Pituitary Adenoma	Pituitary adenoma	BEFREE	22166531		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Cerebrovascular Accidents	Stroke	BEFREE	27377914, 28724170		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	11836446, 28000876		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	24788683		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	15520175, 15725809, 21254935, 24386080, 28814946, 30335898, 7546777		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	17056474		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	17056474, 18006928		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	15086970, 31085806		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	17453001, 9368678		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	11904318, 24194259		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	LHGDN	18498652		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	28000876		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	18478565		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alveolar rhabdomyosarcoma	Alveolar Rhabdomyosarcoma	BEFREE	23185447		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	36284363	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Early Onset	Alzheimer disease	BEFREE	24964199		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	Pubtator	36284363	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic Ependymoma	Anaplastic Ependymoma	BEFREE	18478565		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	11563770		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	LHGDN	17396438		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	25295265		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	18376307, 31165486		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	29898582		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	29898582		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	12010643		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	21383009, 28796252		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	37511378	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	20501753, 26637371		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	22547392, 32647207	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	14576163, 23383064	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	LHGDN	15625284		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	29144802		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	30910708		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial fibrillation	Pubtator	32682418, 35607269	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	CTD_human_DG	17547689		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune Diseases	BEFREE	24785566		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	27959432, 30323629		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	15725809, 17056474, 18006928, 20403354		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	34684639	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	22199345		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	12907612, 17453001, 21536469, 23720424, 26954072, 28300542, 29129118		★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary Atresia	BEFREE	9398004		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	16642478, 18587251, 21347663		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	CTD_human_DG	21347663		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Injuries Traumatic	Brain injuries	Pubtator	22543850	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Cancer, Familial	Breast Cancer	BEFREE	15986122		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10364250, 10612431, 11517158, 12925957, 1377187, 1381277, 15026367, 15298948, 15538047, 15642160, 15668470, 15756268, 15986122, 16214911, 16215864 View all (48 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Diseases	Breast disease	Pubtator	17210081	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Diseases	Breast disease	Pubtator	19551864	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	10347201, 10364250, 10811646, 10993898, 10998426, 11751851, 15642160, 16404426, 16537700, 17121430, 17210081, 17446556, 17922461, 19414355, 19551864 View all (22 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	12433918, 15026367, 17418982	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cachexia	Cachexia	Pubtator	37014770	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	19491931, 19603096, 19846909, 20003326, 24586243, 37397026	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	14694521, 1716700, 31158304		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	24505115	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	12521301, 22401581, 37397026	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	15661074, 16015705, 16965600, 17717605, 21737444, 25556430, 35871161, 38177295	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	15642160	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	21347663, 21892705		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	10793110, 10974650, 12068000, 18450319, 21254935, 21447628, 23185474, 23498137, 24310658, 24339922, 28330997, 29683727, 30870512		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	27579675, 34061869	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	15086466, 16707423, 1716700, 27976731, 36901940	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	15140235	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	21254935	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Transitional Cell	Transitional cell carcinoma	Pubtator	17541304	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Endometrioid	Endometrioid cancer	LHGDN	17952116		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	16445635, 19858071, 21422097, 31513316		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	15466497, 19223521, 30910708		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	10934618	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Central Precocious Puberty	Central Precocious Puberty	BEFREE	30249230		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	LHGDN	17912004		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	LHGDN	12508918		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	27377914, 28724170		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	14599874, 17709267		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	14599874, 17709267, 24292684		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	28000876		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	18478565		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	19647223		★★★★★ ★☆☆☆☆ Found in Text Mining only
Choroid Plexus Papilloma	Choroid Plexus Papilloma	BEFREE	30249230		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	20144192		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	30182733		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	29113370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Clear-cell metastatic renal cell carcinoma	Renal Carcinoma	BEFREE	15661050		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	27253188		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	10029281, 10897042, 15247132, 16448675, 16489531, 22565227		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Polyps	Colonic polyps	Pubtator	20580999	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	15247132, 15668488, 15894673, 15894694, 15941947, 16322329, 17096329, 18031946, 18084616, 19098285, 19492232, 19784788, 21525788, 23527244, 23527725 View all (11 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	CTD_human_DG	21278247		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	15894694, 18084616		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	18084616, 19098285, 21278247, 22354904, 22565227, 23527725, 24175768, 25127039, 25557790, 25822686, 26258407, 29023587, 31884074, 34814249, 37090726, 9218734 View all (1 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	18498652, 22354904	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	CTD_human_DG	21278247		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital atresia of extrahepatic bile duct	Extrahepatic Biliary Atresia	BEFREE	9398004		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	15753986, 21314884, 27038904, 27976731, 28484923		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	25977383		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	23423640, 25977383		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	23423640	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	LHGDN	17763192		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	25977383		★★★★★ ★☆☆☆☆ Found in Text Mining only
Critical Illness	Critical illness	Pubtator	26427594	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	20848532		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	20848532	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	LHGDN	15379965		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	21068693, 26328275		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	16257278		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	29155799		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	27755861	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	12890810, 16548790, 23015654, 25966254, 29040592, 29214310, 29250665, 30898176		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	20144210, 31424259	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	12890810, 16548790, 23015654, 25966254, 25977383, 27038904, 29040592, 29214310, 29250665, 30898176		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	22482470, 29214310	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	24143239, 25073020, 25966254	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	29214310	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	29249623, 29989677, 30179684		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	15761241, 20144192, 22548717, 26402757, 28851702, 29214310, 29250665, 31235487, 31669066		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	31669066		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	25073020, 25086184, 25525174	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	25086184, 26015772		★★★★★ ★☆☆☆☆ Found in Text Mining only
Differentiated Thyroid Gland Carcinoma	Thyroid Carcinoma	BEFREE	22415807, 24504452		★★★★★ ★☆☆☆☆ Found in Text Mining only
Donohue Syndrome	Donohue syndrome	Pubtator	26871809	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry Eye Syndromes	BEFREE	29214310		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry eye syndrome	Pubtator	34100890	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	BEFREE	15642160		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	BEFREE	11836270, 24335034, 28743110, 29025428, 30197657, 30988753, 9255230, 9388817		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dwarfism Pituitary	Pituitary dwarfism	Pubtator	27651465, 33762520	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysmorphic features	Dysmorphic Features	BEFREE	10777002, 16940449		★★★★★ ★☆☆☆☆ Found in Text Mining only
Emphysema	Emphysema	Pubtator	16504044	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Emphysema	Emphysema	Pubtator	18295997	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endocrine Gland Neoplasms	Endocrine Gland Neoplasms	BEFREE	14676124		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine system disease	Pubtator	32529760	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	21078522, 22085490		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	21078522, 23028188, 34889221	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrioid carcinoma ovary	Ovarian endometrioid carcinoma	BEFREE	17952116, 20003326		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	10593386, 11474124	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	LHGDN	12571183, 14644829		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	14644829		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ependymoma	Ependymoma	BEFREE	18478565		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epidermolysis Bullosa Dystrophica	Epidermolysis Bullosa	LHGDN	15140235		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epidermolysis Bullosa Dystrophica	Dystrophic epidermolysis bullosa	Pubtator	15140235	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsies Partial	Partial epilepsy	Pubtator	20416304	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epiretinal Membrane	Epiretinal Membrane	BEFREE	24379526		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	16445635, 21422097		★★★★★ ★☆☆☆☆ Found in Text Mining only
Erectile dysfunction	Erectile Dysfunction	BEFREE	23174226		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	15520175, 17457048, 17671705, 26662570, 28596684		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	LHGDN	15517912		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	15517912, 26662570	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	15520175, 17457048, 17671705, 28596684		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	20042640, 22389159, 23232108, 24938707, 26370590, 27035126, 34404882, 35945453	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	15282325, 28652778		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	17056474, 20403354		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	7684390, 9184179		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	31690932		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	34118139	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	15017134		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	16986125		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	19903356	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	14561895, 20501753, 24878287, 25059666, 9927633		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	32433555, 32647207, 33023892	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	35832140	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	14561895, 20501753, 24878287, 25059666, 9927633		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	16700616, 32597148, 36153549	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	25059666, 30641835		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis Focal Segmental	Focal segmental glomerulosclerosis	Pubtator	30709661	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease XIV	Glycogen Storage Disease	BEFREE	28794993		★★★★★ ★☆☆☆☆ Found in Text Mining only
Growth Disorders	Growth disorder	Pubtator	20389102, 21177759, 31835104	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hallopeau-Siemens Disease	DYSTROPHIC EPIDERMOLYSIS BULLOSA	BEFREE	15140235		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head And Neck Neoplasms	LHGDN	17113753		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangioma	Hemangioma	BEFREE	19349369		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	15661074, 22401581		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	Pubtator	22401581, 29507645	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	17210081, 19551864	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG	16367923		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hurthle Cell Tumor	Tumor	BEFREE	15661050		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	30659610		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	17785698, 18303074		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism, Primary	Hyperparathyroidism	BEFREE	9024241		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	28105631, 34001234	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	BEFREE	28105631		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperthyroidism	Hyperthyroidism	BEFREE	19064126		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	11194704		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	LHGDN	12135130		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophic obstructive cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	11194704		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	11956148, 16548790, 8760024		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	Pubtator	1697608, 28900071	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	BEFREE	19064126, 28672739		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	16723126	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	20215856	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	15681824, 22900087		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	LHGDN	15681824		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	23015654, 29155799		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	LHGDN	11914023, 15844718		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	29573252		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	23383064, 28478612, 29023587	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin resistance - type A	Insulin resistance syndrome	BEFREE	17785698		★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin-Like Growth Factor I Deficiency	Insulin-Like Growth Factor I Deficiency	BEFREE	22419735, 30197657		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	26489762	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	30370550		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intraepithelial Neoplasia	Intraepithelial Neoplasia	BEFREE	15538047		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic Attack Transient	Transient ischemic attack	Pubtator	29385837	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic cardiomyopathy	Ischemic myocardial dysfunction	BEFREE	19332270		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	28724170		★★★★★ ★☆☆☆☆ Found in Text Mining only
Isolated somatotropin deficiency	Isolated Somatotropin Deficiency	BEFREE	11238520, 11836270, 14614229, 15583470, 18303074, 18984657, 22026507, 23436191, 25116472, 28068655, 30197657, 31835104		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kashin-Beck Disease	Kashin-Beck Disease	BEFREE	29948913		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	LHGDN	18534134		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	20144192	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	9767523		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	20144192		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	16707423, 19603096	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Laron Syndrome	Laron Syndrome	BEFREE	11549873, 16548790, 17350302, 21968387, 28502327, 28743110		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leigh Disease	Leigh syndrome	Pubtator	36549505	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	9184179	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	15026318	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	30429106		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	19080118		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	10601571, 10766424, 11804742, 12200149, 12521301, 15661074, 16211216, 16965600, 20599318, 21737444, 23878061, 25556430, 25739014, 25998745, 28521445, 29113370, 31771612 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	11804742, 11959812, 16211216, 16965600		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	16015705, 29113370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	LHGDN	16015705		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	16015705, 20473581	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	31690932	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases Alcoholic	Liver disease	Pubtator	36582223	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	21737444		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	12011225, 12068000, 12473575, 18450319		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	21254935, 22347413, 24339922, 28662101	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	21447628, 28330997		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	31085806	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	34646335, 35197962	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	19004037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	LHGDN	19004037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	24386080, 27035126	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	26662570	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	17096329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10364250, 10612431, 11517158, 12925957, 15026367, 15298948, 15538047, 15642160, 15668470, 15756268, 15986122, 16214911, 16215864, 16284492, 16306136 View all (47 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	21078522, 22085490		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	15520175, 17457048, 17671705, 28596684, 9809981		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	1716700		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	21737444, 22401581		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	10793110, 10974650, 12068000, 18450319, 21254935, 21447628, 23185474, 23498137, 24310658, 24339922, 28330997, 29683727, 30870512		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	19080118		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	19858071, 31513316		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	21852217, 26975989, 28420208, 28681154		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	10613344, 11597555, 11948969, 12907612, 14693733, 14694521, 15067329, 15318950, 15651061, 15734965, 15800934, 16541420, 16825320, 16898267, 17164371 View all (37 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	15318950, 16000583, 24586243		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	15017134, 17096329, 18287864, 20860465, 24386080, 25662950, 27793525		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG	16367923		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	21347663, 21892705		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	CTD_human_DG	21347663		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11238520, 12890810, 14712493, 15067329, 15140235, 16211216, 16214911, 16488932, 16723126, 16773633, 16825320, 16965600, 17709267, 17724372, 19223521 View all (33 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	14599874, 17709267		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	10897042, 11920634, 15247132, 16448675, 16489531, 22565227, 9809981		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	19477944		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12150454, 12242693, 12925957, 12926118, 15070968, 15221971, 15298948, 15802501, 15986122, 16306136, 17051426, 17063263, 17287408, 17446556, 17972510, 18375957, 18471292, 18596909 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	19919528, 21562710, 22751133, 25449421, 25614235, 29217518, 8609661		★★★★★ ★☆☆☆☆ Found in Text Mining only
Manic	Manic Disorder	BEFREE	29898582		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	18478565		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	27255663	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	17172410, 19588500, 20357812, 27377812		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	17172410		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	20357812	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
MENTAL RETARDATION, X-LINKED, SNYDER-ROBINSON TYPE	Mental retardation	BEFREE	10434128		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	30287811	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	LHGDN	16915540		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	17560154, 27465937, 29144802		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	19588500, 27377812		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	23015654, 26402757		★★★★★ ★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	CTD_human_DG	18539642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multinodular goiter	Multinodular goiter	BEFREE	29081797		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	27111220	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	16295526	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	28460598		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis, Relapsing-Remitting	Multiple Sclerosis	BEFREE	28460598		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	LHGDN	15703779		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	29482621		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	11194704, 14671411		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	CTD_human_DG	16214533		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	27658775		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	27658775	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	32703944	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neonatal hypoglycemia	Hypoglycemia	BEFREE	15583470		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10468998, 11504910, 11804742, 11948969, 12473575, 12907612, 1381277, 15017134, 15140235, 15520175, 15661074, 15769996, 15781645, 16015705, 16211216 View all (60 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	14561895, 29202477		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	29202477	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	12068000, 12473575, 1372941, 16049980, 20023704, 20145156, 21254935, 21447628, 21551235, 21805046, 22543588, 24942865, 25482372, 28330997, 28378642, 29772705, 31366504, 8675593 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
NONAKA MYOPATHY	Inclusion body myopathy	BEFREE	25081695		★★★★★ ★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	15642160		★★★★★ ★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	LHGDN	15642160		★★★★★ ★☆☆☆☆ Found in Text Mining only
Noonan Syndrome	Noonan Syndrome	BEFREE	19407499		★★★★★ ★☆☆☆☆ Found in Text Mining only
Noonan Syndrome	Noonan syndrome	Pubtator	34858328	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	15489542, 23383064, 23527725, 27553225, 29023587, 29112142, 30287811, 36384443, 37511378	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	23527725, 28484923, 28672739, 29112142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity Morbid	Obesity	Pubtator	29112142	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity, Morbid	Obesity	BEFREE	29112142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	17693100, 18775662, 23036517, 29547667	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis of hip	Osteoarthritis Of Hip	BEFREE	24928840		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	38260127	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	11325513, 15095405, 8550801, 9322936		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	20340016, 32129151	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosclerosis	Osteosclerosis	Pubtator	9593772	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	15014034		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	19858071, 31513316		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	16773633, 19858071, 20003326, 33282953, 37155466, 38583177	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Oxyphilic Adenoma	Oxyphilic Adenoma	BEFREE	15661050		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	21852217, 26975989, 28420208, 28681154		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	26975989, 31165486		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	12641820	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	20416304, 23962053, 24471499, 27539223, 29157747, 36864505	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	12641820	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	BEFREE	14599874		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	39533574	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peptic Esophagitis	Peptic Esophagitis	BEFREE	20403354		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	20860589		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	36389665	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
PIGMENTARY DISORDER, RETICULATE, WITH SYSTEMIC MANIFESTATIONS	Pigmentary Disorder, Reticulate, With Systemic Manifestations	BEFREE	24379526		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary dwarfism	Pituitary dwarfism	BEFREE	22026507, 23436191, 25116472, 31835104		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	20452586	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyp of large intestine	Polyp Of Large Intestine	BEFREE	19784788, 20580999, 25385818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prader-Willi-like syndrome	Prader-Willi-Like Syndrome	BEFREE	29496979		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	28000876		★★★★★ ★☆☆☆☆ Found in Text Mining only
Premature aging syndrome	Premature aging	BEFREE	7688372		★★★★★ ★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	29155799		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	10613344, 11597555, 11948969, 12907612, 14693733, 14694521, 15067329, 15318950, 15651061, 15734965, 15800934, 16541420, 16825320, 16898267, 17164371 View all (37 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic Hyperplasia	LHGDN	12111701		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	24367483, 29129118	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	BEFREE	23011725, 8550786		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	11784719, 11948969, 12122101, 15067329, 15651061, 16775172, 17434920, 17453001, 17668637, 17719815, 17959403, 18162523		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	11836256, 19491931	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	15318950, 16000583, 24586243		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	16847815, 17453001, 17668637, 18162523, 18163429, 19491931, 19853487, 20484221, 21677876, 22879989, 23011725, 24394557, 24497940, 24586243, 24713434 View all (7 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	21697285		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Proteinuria	Proteinuria	Pubtator	18441509	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pterygium	Pterygium	BEFREE	16488932		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	36101791	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	16504044		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	19004037, 21898349		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	21898349	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	LHGDN	15086466, 15661050		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	15753986, 1716700, 21314884, 27038904, 27976731, 28484923		★★★★★ ★☆☆☆☆ Found in Text Mining only
Resistance to Insulin-Like Growth Factor I	IGF-I RESISTANCE	BEFREE	19574224, 25066218		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	26427594		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	17567756, 24953254		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal detachment	Pubtator	25073020, 25086184	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	16211216, 19919528		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy	BEFREE	17567756, 28934640		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rett Syndrome	Rett Syndrome	BEFREE	17278996, 29522154		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma Alveolar	Rhabdomyosarcoma	Pubtator	23185447	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatic Heart Disease	Rheumatic Heart Disease	BEFREE	16406300		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	17379860, 25352179, 27775453, 31430609		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	CTD_human_DG	17379860		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Russell-Silver syndrome	Russell-Silver Syndrome	BEFREE	10364674, 10434128, 18230663, 28675902		★★★★★ ★☆☆☆☆ Found in Text Mining only
Russell-Silver syndrome	Russell-Silver Syndrome	GENOMICS_ENGLAND_DG	10364674		★★★★★ ★☆☆☆☆ Found in Text Mining only
Salivary Gland Pleomorphic Adenoma	Pleomorphic adenoma of salivary gland	BEFREE	23011725		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	LHGDN	15282325		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	15282325, 23185447	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	Pubtator	15967097	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe myopia	Myopia	BEFREE	22332214		★★★★★ ★☆☆☆☆ Found in Text Mining only
SHORT STATURE, IDIOPATHIC, X-LINKED	SHORT STATURE, IDIOPATHIC, X-LINKED	BEFREE	26400282		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin neoplasm	Pubtator	24022308	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	1372941		★★★★★ ★☆☆☆☆ Found in Text Mining only
Somatotropin deficiency	Somatotropin Deficiency	BEFREE	15583470, 18984657, 27651465, 29982753, 30197657, 30332395		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spondylarthritis	Spondyloarthritis	BEFREE	29471593		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	15140235, 15520175, 15781645, 15809747, 18568082, 21254935, 26540630, 28551677, 28814946, 29123408		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	15140235, 19020726		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	20042640, 21195059, 22389159, 24938707, 26349977, 26670461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	24802266, 25945837, 31304688, 35798794	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	28807942, 30323629		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	21551235, 22494072, 24802266, 25945837, 28551677		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	15017134, 17096329, 18287864, 20860465, 24386080, 24451943, 25662950, 27793525		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	12051736, 18287864		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG	16367923		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	16367923, 24386080, 25081695, 25590353, 28275299	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Systemic onset juvenile chronic arthritis	Arthritis	BEFREE	11606449		★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	19004037, 21898349, 22796227, 22900087		★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	LHGDN	19004037		★★★★★ ★☆☆☆☆ Found in Text Mining only
TARSAL-CARPAL COALITION SYNDROME	Tarsal-Carpal Coalition Syndrome	BEFREE	17541304, 21347663		★★★★★ ★☆☆☆☆ Found in Text Mining only
Testicular Feminization	Testicular Feminization	BEFREE	12876417		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	32610693	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid Diseases	BEFREE	29081797		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	22415807	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	22415807	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Nodule	Thyroid Nodule	BEFREE	29081797		★★★★★ ★☆☆☆☆ Found in Text Mining only
Transient Ischemic Attack	Transient Ischemic Attack	BEFREE	30010432		★★★★★ ★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	21347663		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	24167614, 30725116	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	24337110, 28778177, 29623068, 30725116		★★★★★ ★☆☆☆☆ Found in Text Mining only
Turner Syndrome	Turner Syndrome	BEFREE	12050253, 16291706, 17067837, 17540594, 22278433, 9100570		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Turner Syndrome	Turner syndrome	Pubtator	22278433	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	16052224	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	17541304, 28882129, 36131343	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine Cervical Dysplasia	Uterine disease	Pubtator	12163384	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	30643822	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	7684390, 9184179		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin D Deficiency	BEFREE	29470176		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	23555779	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Werner Syndrome	Werner syndrome	Pubtator	1712899, 1719537	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Werner Syndrome	Werner Syndrome	BEFREE	1719537, 7688372, 7693501		★★★★★ ★☆☆☆☆ Found in Text Mining only

IGFBP3 (insulin like growth factor binding protein 3)