Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	3481
Gene name	Insulin like growth factor 2
Gene symbol	IGF2
Synonyms (NCBI Gene)	C11orf43GRDFIGF-IIPP9974SRS3
Chromosome	11
Chromosome location	11p15.5
Summary	This gene encodes a member of the insulin family of polypeptide growth factors, which are involved in development and growth. It is an imprinted gene, expressed only from the paternal allele, and epigenetic changes at this locus are associated with Wilms

811

Show/Hide all (811)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004520	hsa-let-7a-5p	Luciferase reporter assay	17974952
MIRT005738	hsa-miR-125b-5p	Luciferase reporter assayNorthern blotWestern blot	21200031
MIRT005738	hsa-miR-125b-5p	Luciferase reporter assayNorthern blotWestern blot	21200031
MIRT005739	hsa-miR-150-5p	Luciferase reporter assay	21200031
MIRT005739	hsa-miR-150-5p	Luciferase reporter assay	21200031
MIRT007015	hsa-miR-615-5p	Luciferase reporter assay	22819824
MIRT048842	hsa-miR-93-5p	CLASH	23622248
MIRT037339	hsa-miR-877-5p	CLASH	23622248
MIRT052999	hsa-miR-100-5p	Northern blotqRT-PCRWestern blotLuciferase reporter assay	22926517
MIRT052999	hsa-miR-100-5p	Northern blotqRT-PCRWestern blot	22926517
MIRT709525	hsa-miR-3200-3p	HITS-CLIP	19536157
MIRT709524	hsa-miR-1224-3p	HITS-CLIP	19536157
MIRT709523	hsa-miR-4707-5p	HITS-CLIP	19536157
MIRT709522	hsa-miR-5587-3p	HITS-CLIP	19536157
MIRT709521	hsa-miR-3162-3p	HITS-CLIP	19536157
MIRT709520	hsa-miR-4485-5p	HITS-CLIP	19536157
MIRT709519	hsa-miR-1915-5p	HITS-CLIP	19536157
MIRT709518	hsa-miR-6078	HITS-CLIP	19536157
MIRT709517	hsa-miR-6784-3p	HITS-CLIP	19536157
MIRT709516	hsa-miR-6862-3p	HITS-CLIP	19536157
MIRT709515	hsa-miR-6790-3p	HITS-CLIP	19536157
MIRT709514	hsa-miR-6821-3p	HITS-CLIP	19536157
MIRT709513	hsa-miR-6802-3p	HITS-CLIP	19536157
MIRT709512	hsa-miR-6763-3p	HITS-CLIP	19536157
MIRT709511	hsa-miR-3622a-3p	HITS-CLIP	19536157
MIRT709510	hsa-miR-4728-3p	HITS-CLIP	19536157
MIRT640648	hsa-miR-8084	HITS-CLIP	23824327
MIRT640649	hsa-miR-200b-3p	HITS-CLIP	23824327
MIRT640647	hsa-miR-200c-3p	HITS-CLIP	23824327
MIRT640646	hsa-miR-429	HITS-CLIP	23824327
MIRT640644	hsa-miR-5003-3p	HITS-CLIP	23824327
MIRT640645	hsa-miR-4662a-5p	HITS-CLIP	23824327
MIRT493537	hsa-miR-320a	PAR-CLIP	23592263
MIRT493536	hsa-miR-320b	PAR-CLIP	23592263
MIRT493535	hsa-miR-320c	PAR-CLIP	23592263
MIRT493534	hsa-miR-320d	PAR-CLIP	23592263
MIRT493533	hsa-miR-4429	PAR-CLIP	23592263
MIRT493532	hsa-miR-4428	PAR-CLIP	23592263
MIRT493531	hsa-miR-3173-3p	PAR-CLIP	23592263
MIRT493529	hsa-miR-6891-5p	PAR-CLIP	23592263
MIRT493530	hsa-miR-4779	PAR-CLIP	23592263
MIRT493528	hsa-miR-4521	PAR-CLIP	23592263
MIRT493527	hsa-miR-339-3p	PAR-CLIP	23592263
MIRT493526	hsa-miR-1914-3p	PAR-CLIP	23592263
MIRT493525	hsa-miR-5194	PAR-CLIP	23592263
MIRT493524	hsa-miR-6738-5p	PAR-CLIP	23592263
MIRT493523	hsa-miR-6881-5p	PAR-CLIP	23592263
MIRT493522	hsa-miR-9-3p	PAR-CLIP	23592263
MIRT731345	hsa-miR-663b	Luciferase reporter assayqRT-PCRWestern blot	27895308
MIRT731345	hsa-miR-663b	Luciferase reporter assayqRT-PCRWestern blot	27895308
MIRT007015	hsa-miR-615-5p	ELISALuciferase reporter assay	24769899
MIRT007015	hsa-miR-615-5p	ELISALuciferase reporter assay	24769899
MIRT493528	hsa-miR-4521	Immunohistochemistry (IHC)Immunoprecipitaion (IP)Luciferase reporter assayqRT-PCRWestern blotting	33407516
MIRT736478	hsa-miR-195-3p	Western blottingImmunoprecipitaion (IP)ImmunofluorescenceqRT-PCRFlow cytometry	33173015
MIRT736735	hsa-miR-483-5p	MicroarrayqRT-PCR	26555194
MIRT737343	hsa-miR-23a-5p	Luciferase reporter assayWestern blottingImmunohistochemistry (IHC)qRT-PCR	32323783
MIRT709525	hsa-miR-3200-3p	HITS-CLIP	19536157
MIRT709524	hsa-miR-1224-3p	HITS-CLIP	19536157
MIRT709523	hsa-miR-4707-5p	HITS-CLIP	19536157
MIRT709522	hsa-miR-5587-3p	HITS-CLIP	19536157
MIRT709521	hsa-miR-3162-3p	HITS-CLIP	19536157
MIRT709520	hsa-miR-4485-5p	HITS-CLIP	19536157
MIRT709519	hsa-miR-1915-5p	HITS-CLIP	19536157
MIRT709518	hsa-miR-6078	HITS-CLIP	19536157
MIRT709517	hsa-miR-6784-3p	HITS-CLIP	19536157
MIRT709516	hsa-miR-6862-3p	HITS-CLIP	19536157
MIRT709515	hsa-miR-6790-3p	HITS-CLIP	19536157
MIRT709514	hsa-miR-6821-3p	HITS-CLIP	19536157
MIRT709513	hsa-miR-6802-3p	HITS-CLIP	19536157
MIRT709512	hsa-miR-6763-3p	HITS-CLIP	19536157
MIRT709511	hsa-miR-3622a-3p	HITS-CLIP	19536157
MIRT709510	hsa-miR-4728-3p	HITS-CLIP	19536157
MIRT640648	hsa-miR-8084	HITS-CLIP	23824327
MIRT640649	hsa-miR-200b-3p	HITS-CLIP	23824327
MIRT640647	hsa-miR-200c-3p	HITS-CLIP	23824327
MIRT640646	hsa-miR-429	HITS-CLIP	23824327
MIRT640644	hsa-miR-5003-3p	HITS-CLIP	23824327
MIRT640645	hsa-miR-4662a-5p	HITS-CLIP	23824327
MIRT493537	hsa-miR-320a	PAR-CLIP	23592263
MIRT493536	hsa-miR-320b	PAR-CLIP	23592263
MIRT493535	hsa-miR-320c	PAR-CLIP	23592263
MIRT493534	hsa-miR-320d	PAR-CLIP	23592263
MIRT493533	hsa-miR-4429	PAR-CLIP	23592263
MIRT493532	hsa-miR-4428	PAR-CLIP	23592263
MIRT493531	hsa-miR-3173-3p	PAR-CLIP	23592263
MIRT493529	hsa-miR-6891-5p	PAR-CLIP	23592263
MIRT493530	hsa-miR-4779	PAR-CLIP	23592263
MIRT493528	hsa-miR-4521	PAR-CLIP	23592263
MIRT493527	hsa-miR-339-3p	PAR-CLIP	23592263
MIRT493526	hsa-miR-1914-3p	PAR-CLIP	23592263
MIRT493525	hsa-miR-5194	PAR-CLIP	23592263
MIRT493524	hsa-miR-6738-5p	PAR-CLIP	23592263
MIRT493523	hsa-miR-6881-5p	PAR-CLIP	23592263
MIRT493522	hsa-miR-9-3p	PAR-CLIP	23592263
MIRT1061828	hsa-miR-1324	CLIP-seq
MIRT1061829	hsa-miR-3150a-3p	CLIP-seq
MIRT1061830	hsa-miR-3175	CLIP-seq
MIRT1061831	hsa-miR-3940-3p	CLIP-seq
MIRT1061832	hsa-miR-4514	CLIP-seq
MIRT1061833	hsa-miR-4640-5p	CLIP-seq
MIRT1061834	hsa-miR-4651	CLIP-seq
MIRT1061835	hsa-miR-4692	CLIP-seq
MIRT1061836	hsa-miR-4726-5p	CLIP-seq
MIRT1061837	hsa-miR-4776-3p	CLIP-seq
MIRT1061838	hsa-miR-491-5p	CLIP-seq
MIRT1061839	hsa-miR-583	CLIP-seq
MIRT1061840	hsa-miR-608	CLIP-seq
MIRT1061841	hsa-miR-939	CLIP-seq
MIRT1061842	hsa-miR-1225-3p	CLIP-seq
MIRT1061843	hsa-miR-125a-3p	CLIP-seq
MIRT1061844	hsa-miR-147	CLIP-seq
MIRT1061845	hsa-miR-1972	CLIP-seq
MIRT1061846	hsa-miR-210	CLIP-seq
MIRT1061847	hsa-miR-2467-3p	CLIP-seq
MIRT1061848	hsa-miR-3194-5p	CLIP-seq
MIRT1061849	hsa-miR-3667-3p	CLIP-seq
MIRT1061850	hsa-miR-3926	CLIP-seq
MIRT1061851	hsa-miR-3934	CLIP-seq
MIRT1061852	hsa-miR-3943	CLIP-seq
MIRT1061853	hsa-miR-4313	CLIP-seq
MIRT1061854	hsa-miR-4321	CLIP-seq
MIRT1061855	hsa-miR-4639-3p	CLIP-seq
MIRT1061856	hsa-miR-4650-5p	CLIP-seq
MIRT1061857	hsa-miR-4667-3p	CLIP-seq
MIRT1061858	hsa-miR-4781-5p	CLIP-seq
MIRT1061859	hsa-miR-548s	CLIP-seq
MIRT1061860	hsa-miR-599	CLIP-seq
MIRT1061861	hsa-miR-640	CLIP-seq
MIRT1061862	hsa-miR-665	CLIP-seq
MIRT1061863	hsa-miR-764	CLIP-seq
MIRT1061864	hsa-miR-2467-5p	CLIP-seq
MIRT1061865	hsa-miR-3188	CLIP-seq
MIRT1061866	hsa-miR-3975	CLIP-seq
MIRT1061867	hsa-miR-4259	CLIP-seq
MIRT1061868	hsa-miR-4260	CLIP-seq
MIRT1061869	hsa-miR-4283	CLIP-seq
MIRT1061870	hsa-miR-4489	CLIP-seq
MIRT1061871	hsa-miR-4492	CLIP-seq
MIRT1061872	hsa-miR-4498	CLIP-seq
MIRT1061873	hsa-miR-4505	CLIP-seq
MIRT1061874	hsa-miR-4649-3p	CLIP-seq
MIRT1061875	hsa-miR-4656	CLIP-seq
MIRT1061876	hsa-miR-4731-5p	CLIP-seq
MIRT1061877	hsa-miR-485-5p	CLIP-seq
MIRT1061878	hsa-miR-762	CLIP-seq
MIRT1061854	hsa-miR-4321	CLIP-seq
MIRT1061858	hsa-miR-4781-5p	CLIP-seq
MIRT1061861	hsa-miR-640	CLIP-seq
MIRT1549747	hsa-miR-105	CLIP-seq
MIRT1549748	hsa-miR-1193	CLIP-seq
MIRT1549749	hsa-miR-1205	CLIP-seq
MIRT1549750	hsa-miR-1237	CLIP-seq
MIRT1549751	hsa-miR-1245b-5p	CLIP-seq
MIRT1549752	hsa-miR-1246	CLIP-seq
MIRT1549753	hsa-miR-1248	CLIP-seq
MIRT1549754	hsa-miR-1253	CLIP-seq
MIRT1061843	hsa-miR-125a-3p	CLIP-seq
MIRT1549755	hsa-miR-1275	CLIP-seq
MIRT1549756	hsa-miR-1286	CLIP-seq
MIRT1549757	hsa-miR-1290	CLIP-seq
MIRT1549758	hsa-miR-1293	CLIP-seq
MIRT1061828	hsa-miR-1324	CLIP-seq
MIRT1549759	hsa-miR-138	CLIP-seq
MIRT1549760	hsa-miR-141	CLIP-seq
MIRT1061844	hsa-miR-147	CLIP-seq
MIRT1549761	hsa-miR-155	CLIP-seq
MIRT1549762	hsa-miR-1587	CLIP-seq
MIRT1549763	hsa-miR-181a	CLIP-seq
MIRT1549764	hsa-miR-181b	CLIP-seq
MIRT1549765	hsa-miR-181c	CLIP-seq
MIRT1549766	hsa-miR-181d	CLIP-seq
MIRT1549767	hsa-miR-1827	CLIP-seq
MIRT1549768	hsa-miR-188-3p	CLIP-seq
MIRT1549769	hsa-miR-1908	CLIP-seq
MIRT1549770	hsa-miR-1909	CLIP-seq
MIRT1549771	hsa-miR-1913	CLIP-seq
MIRT1549772	hsa-miR-1915	CLIP-seq
MIRT1549773	hsa-miR-193a-5p	CLIP-seq
MIRT1061845	hsa-miR-1972	CLIP-seq
MIRT1549774	hsa-miR-1976	CLIP-seq
MIRT1549775	hsa-miR-19a	CLIP-seq
MIRT1549776	hsa-miR-19b	CLIP-seq
MIRT1549777	hsa-miR-200a	CLIP-seq
MIRT1549778	hsa-miR-2110	CLIP-seq
MIRT1549779	hsa-miR-2392	CLIP-seq
MIRT1549780	hsa-miR-24	CLIP-seq
MIRT1061847	hsa-miR-2467-3p	CLIP-seq
MIRT1549781	hsa-miR-299-3p	CLIP-seq
MIRT1549782	hsa-miR-3127-5p	CLIP-seq
MIRT1549783	hsa-miR-3134	CLIP-seq
MIRT1549784	hsa-miR-3136-3p	CLIP-seq
MIRT1549785	hsa-miR-3142	CLIP-seq
MIRT1549786	hsa-miR-3144-5p	CLIP-seq
MIRT1061829	hsa-miR-3150a-3p	CLIP-seq
MIRT1549787	hsa-miR-3150b-3p	CLIP-seq
MIRT1549788	hsa-miR-3151	CLIP-seq
MIRT1549789	hsa-miR-3158-5p	CLIP-seq
MIRT1549790	hsa-miR-3160-3p	CLIP-seq
MIRT1549791	hsa-miR-3166	CLIP-seq
MIRT1549792	hsa-miR-3167	CLIP-seq
MIRT1549793	hsa-miR-3170	CLIP-seq
MIRT1061830	hsa-miR-3175	CLIP-seq
MIRT1549794	hsa-miR-3179	CLIP-seq
MIRT1549795	hsa-miR-3182	CLIP-seq
MIRT1549796	hsa-miR-3189-5p	CLIP-seq
MIRT1549797	hsa-miR-3191	CLIP-seq
MIRT1549798	hsa-miR-3194-3p	CLIP-seq
MIRT1061848	hsa-miR-3194-5p	CLIP-seq
MIRT1549799	hsa-miR-3195	CLIP-seq
MIRT1549800	hsa-miR-3199	CLIP-seq
MIRT1549801	hsa-miR-324-3p	CLIP-seq
MIRT1549802	hsa-miR-329	CLIP-seq
MIRT1549803	hsa-miR-342-5p	CLIP-seq
MIRT1549804	hsa-miR-3611	CLIP-seq
MIRT1549805	hsa-miR-3620	CLIP-seq
MIRT1549806	hsa-miR-3622a-5p	CLIP-seq
MIRT1549807	hsa-miR-362-3p	CLIP-seq
MIRT1549808	hsa-miR-3665	CLIP-seq
MIRT1061849	hsa-miR-3667-3p	CLIP-seq
MIRT1549809	hsa-miR-3677-5p	CLIP-seq
MIRT1549810	hsa-miR-3688-3p	CLIP-seq
MIRT1549811	hsa-miR-370	CLIP-seq
MIRT1549812	hsa-miR-3713	CLIP-seq
MIRT1549813	hsa-miR-371b-3p	CLIP-seq
MIRT1549814	hsa-miR-3909	CLIP-seq
MIRT1549815	hsa-miR-3911	CLIP-seq
MIRT1061850	hsa-miR-3926	CLIP-seq
MIRT1061851	hsa-miR-3934	CLIP-seq
MIRT1061831	hsa-miR-3940-3p	CLIP-seq
MIRT1061852	hsa-miR-3943	CLIP-seq
MIRT1549816	hsa-miR-3944-3p	CLIP-seq
MIRT1549817	hsa-miR-3944-5p	CLIP-seq
MIRT1549818	hsa-miR-410	CLIP-seq
MIRT1061868	hsa-miR-4260	CLIP-seq
MIRT1549819	hsa-miR-4261	CLIP-seq
MIRT1549820	hsa-miR-4262	CLIP-seq
MIRT1549821	hsa-miR-4265	CLIP-seq
MIRT1549822	hsa-miR-4269	CLIP-seq
MIRT1549823	hsa-miR-4276	CLIP-seq
MIRT1549824	hsa-miR-4285	CLIP-seq
MIRT1549825	hsa-miR-4286	CLIP-seq
MIRT1549826	hsa-miR-4293	CLIP-seq
MIRT1549827	hsa-miR-4296	CLIP-seq
MIRT1549828	hsa-miR-4302	CLIP-seq
MIRT1549829	hsa-miR-4303	CLIP-seq
MIRT1061853	hsa-miR-4313	CLIP-seq
MIRT1549830	hsa-miR-4322	CLIP-seq
MIRT1549831	hsa-miR-4323	CLIP-seq
MIRT1549832	hsa-miR-4327	CLIP-seq
MIRT1549833	hsa-miR-4328	CLIP-seq
MIRT1549834	hsa-miR-4417	CLIP-seq
MIRT1549835	hsa-miR-4423-3p	CLIP-seq
MIRT1549836	hsa-miR-4426	CLIP-seq
MIRT1549837	hsa-miR-4433	CLIP-seq
MIRT1549838	hsa-miR-4434	CLIP-seq
MIRT1549839	hsa-miR-4437	CLIP-seq
MIRT1549840	hsa-miR-4447	CLIP-seq
MIRT1549841	hsa-miR-4450	CLIP-seq
MIRT1549842	hsa-miR-4455	CLIP-seq
MIRT1549843	hsa-miR-4459	CLIP-seq
MIRT1549844	hsa-miR-4460	CLIP-seq
MIRT1549845	hsa-miR-4472	CLIP-seq
MIRT1549846	hsa-miR-4483	CLIP-seq
MIRT1549847	hsa-miR-4487	CLIP-seq
MIRT1061871	hsa-miR-4492	CLIP-seq
MIRT1061872	hsa-miR-4498	CLIP-seq
MIRT1549848	hsa-miR-4501	CLIP-seq
MIRT1549849	hsa-miR-450b-3p	CLIP-seq
MIRT1061832	hsa-miR-4514	CLIP-seq
MIRT1549850	hsa-miR-4515	CLIP-seq
MIRT1549851	hsa-miR-4516	CLIP-seq
MIRT1549852	hsa-miR-4520a-5p	CLIP-seq
MIRT1549853	hsa-miR-4520b-5p	CLIP-seq
MIRT1549854	hsa-miR-4523	CLIP-seq
MIRT1549855	hsa-miR-4532	CLIP-seq
MIRT1549856	hsa-miR-4534	CLIP-seq
MIRT1549857	hsa-miR-4632	CLIP-seq
MIRT1061833	hsa-miR-4640-5p	CLIP-seq
MIRT1549858	hsa-miR-4647	CLIP-seq
MIRT1061856	hsa-miR-4650-5p	CLIP-seq
MIRT1061834	hsa-miR-4651	CLIP-seq
MIRT1549859	hsa-miR-4652-5p	CLIP-seq
MIRT1061875	hsa-miR-4656	CLIP-seq
MIRT1549860	hsa-miR-4660	CLIP-seq
MIRT1549861	hsa-miR-4662b	CLIP-seq
MIRT1549862	hsa-miR-4663	CLIP-seq
MIRT1549863	hsa-miR-4664-5p	CLIP-seq
MIRT1549864	hsa-miR-4665-5p	CLIP-seq
MIRT1549865	hsa-miR-4667-5p	CLIP-seq
MIRT1549866	hsa-miR-4674	CLIP-seq
MIRT1549867	hsa-miR-4679	CLIP-seq
MIRT1061835	hsa-miR-4692	CLIP-seq
MIRT1549868	hsa-miR-4695-3p	CLIP-seq
MIRT1549869	hsa-miR-4695-5p	CLIP-seq
MIRT1549870	hsa-miR-4700-5p	CLIP-seq
MIRT1549871	hsa-miR-4716-3p	CLIP-seq
MIRT1549872	hsa-miR-4722-5p	CLIP-seq
MIRT1061836	hsa-miR-4726-5p	CLIP-seq
MIRT1549873	hsa-miR-4727-3p	CLIP-seq
MIRT1549874	hsa-miR-4733-5p	CLIP-seq
MIRT1549875	hsa-miR-4736	CLIP-seq
MIRT1549876	hsa-miR-4753-3p	CLIP-seq
MIRT1549877	hsa-miR-4758-3p	CLIP-seq
MIRT1549878	hsa-miR-4761-5p	CLIP-seq
MIRT1549879	hsa-miR-4762-3p	CLIP-seq
MIRT1549880	hsa-miR-4768-3p	CLIP-seq
MIRT1549881	hsa-miR-4768-5p	CLIP-seq
MIRT1549882	hsa-miR-4771	CLIP-seq
MIRT1549883	hsa-miR-4775	CLIP-seq
MIRT1549884	hsa-miR-4784	CLIP-seq
MIRT1549885	hsa-miR-4800-5p	CLIP-seq
MIRT1061877	hsa-miR-485-5p	CLIP-seq
MIRT1549886	hsa-miR-490-3p	CLIP-seq
MIRT1549887	hsa-miR-490-5p	CLIP-seq
MIRT1061838	hsa-miR-491-5p	CLIP-seq
MIRT1549888	hsa-miR-499a-5p	CLIP-seq
MIRT1549889	hsa-miR-515-5p	CLIP-seq
MIRT1549890	hsa-miR-542-5p	CLIP-seq
MIRT1061859	hsa-miR-548s	CLIP-seq
MIRT1549891	hsa-miR-552	CLIP-seq
MIRT1549892	hsa-miR-558	CLIP-seq
MIRT1549893	hsa-miR-564	CLIP-seq
MIRT1549894	hsa-miR-566	CLIP-seq
MIRT1549895	hsa-miR-579	CLIP-seq
MIRT1549896	hsa-miR-587	CLIP-seq
MIRT1549897	hsa-miR-602	CLIP-seq
MIRT1549898	hsa-miR-604	CLIP-seq
MIRT1061840	hsa-miR-608	CLIP-seq
MIRT1549899	hsa-miR-609	CLIP-seq
MIRT1549900	hsa-miR-627	CLIP-seq
MIRT1549901	hsa-miR-636	CLIP-seq
MIRT1549902	hsa-miR-637	CLIP-seq
MIRT1549903	hsa-miR-644	CLIP-seq
MIRT1549904	hsa-miR-657	CLIP-seq
MIRT1549905	hsa-miR-659	CLIP-seq
MIRT1549906	hsa-miR-663	CLIP-seq
MIRT1549907	hsa-miR-711	CLIP-seq
MIRT1549908	hsa-miR-744	CLIP-seq
MIRT1061878	hsa-miR-762	CLIP-seq
MIRT1061863	hsa-miR-764	CLIP-seq
MIRT1549909	hsa-miR-765	CLIP-seq
MIRT1549910	hsa-miR-769-3p	CLIP-seq
MIRT1549911	hsa-miR-876-5p	CLIP-seq
MIRT1549912	hsa-miR-891a	CLIP-seq
MIRT1549913	hsa-miR-9	CLIP-seq
MIRT1549914	hsa-miR-933	CLIP-seq
MIRT1061843	hsa-miR-125a-3p	CLIP-seq
MIRT1549756	hsa-miR-1286	CLIP-seq
MIRT1549769	hsa-miR-1908	CLIP-seq
MIRT1549771	hsa-miR-1913	CLIP-seq
MIRT1922125	hsa-miR-2276	CLIP-seq
MIRT1549782	hsa-miR-3127-5p	CLIP-seq
MIRT1922126	hsa-miR-3140-3p	CLIP-seq
MIRT1922127	hsa-miR-323-5p	CLIP-seq
MIRT1549801	hsa-miR-324-3p	CLIP-seq
MIRT1922128	hsa-miR-3685	CLIP-seq
MIRT1922129	hsa-miR-380	CLIP-seq
MIRT1922130	hsa-miR-3918	CLIP-seq
MIRT1922131	hsa-miR-3925-3p	CLIP-seq
MIRT1061853	hsa-miR-4313	CLIP-seq
MIRT1922132	hsa-miR-4495	CLIP-seq
MIRT1549855	hsa-miR-4532	CLIP-seq
MIRT1922133	hsa-miR-4645-5p	CLIP-seq
MIRT1922134	hsa-miR-4668-3p	CLIP-seq
MIRT1922135	hsa-miR-4673	CLIP-seq
MIRT1922136	hsa-miR-4694-3p	CLIP-seq
MIRT1922137	hsa-miR-4772-3p	CLIP-seq
MIRT1922138	hsa-miR-486-3p	CLIP-seq
MIRT1922139	hsa-miR-517a	CLIP-seq
MIRT1922140	hsa-miR-517c	CLIP-seq
MIRT1922141	hsa-miR-522	CLIP-seq
MIRT1922142	hsa-miR-544	CLIP-seq
MIRT1549896	hsa-miR-587	CLIP-seq
MIRT1922143	hsa-miR-626	CLIP-seq
MIRT1549906	hsa-miR-663	CLIP-seq
MIRT1922144	hsa-miR-668	CLIP-seq
MIRT1922145	hsa-miR-766	CLIP-seq
MIRT1922146	hsa-miR-876-3p	CLIP-seq
MIRT1549751	hsa-miR-1245b-5p	CLIP-seq
MIRT1922777	hsa-miR-1295	CLIP-seq
MIRT1922778	hsa-miR-1302	CLIP-seq
MIRT1549771	hsa-miR-1913	CLIP-seq
MIRT1922126	hsa-miR-3140-3p	CLIP-seq
MIRT1549785	hsa-miR-3142	CLIP-seq
MIRT1549786	hsa-miR-3144-5p	CLIP-seq
MIRT1922779	hsa-miR-3165	CLIP-seq
MIRT1549797	hsa-miR-3191	CLIP-seq
MIRT1061848	hsa-miR-3194-5p	CLIP-seq
MIRT1922127	hsa-miR-323-5p	CLIP-seq
MIRT1549801	hsa-miR-324-3p	CLIP-seq
MIRT1549802	hsa-miR-329	CLIP-seq
MIRT1549807	hsa-miR-362-3p	CLIP-seq
MIRT1922131	hsa-miR-3925-3p	CLIP-seq
MIRT1922780	hsa-miR-3978	CLIP-seq
MIRT1922781	hsa-miR-4298	CLIP-seq
MIRT1061853	hsa-miR-4313	CLIP-seq
MIRT1549836	hsa-miR-4426	CLIP-seq
MIRT1922782	hsa-miR-4457	CLIP-seq
MIRT1922133	hsa-miR-4645-5p	CLIP-seq
MIRT1549858	hsa-miR-4647	CLIP-seq
MIRT1549859	hsa-miR-4652-5p	CLIP-seq
MIRT1549861	hsa-miR-4662b	CLIP-seq
MIRT1922135	hsa-miR-4673	CLIP-seq
MIRT1549869	hsa-miR-4695-5p	CLIP-seq
MIRT1922783	hsa-miR-4761-3p	CLIP-seq
MIRT1061838	hsa-miR-491-5p	CLIP-seq
MIRT1922784	hsa-miR-513b	CLIP-seq
MIRT1922139	hsa-miR-517a	CLIP-seq
MIRT1922140	hsa-miR-517c	CLIP-seq
MIRT1922785	hsa-miR-661	CLIP-seq
MIRT1922144	hsa-miR-668	CLIP-seq
MIRT1922145	hsa-miR-766	CLIP-seq
MIRT1922146	hsa-miR-876-3p	CLIP-seq
MIRT1549757	hsa-miR-1290	CLIP-seq
MIRT1061828	hsa-miR-1324	CLIP-seq
MIRT1549772	hsa-miR-1915	CLIP-seq
MIRT1061831	hsa-miR-3940-3p	CLIP-seq
MIRT1549831	hsa-miR-4323	CLIP-seq
MIRT1549837	hsa-miR-4433	CLIP-seq
MIRT1549838	hsa-miR-4434	CLIP-seq
MIRT1549843	hsa-miR-4459	CLIP-seq
MIRT1061832	hsa-miR-4514	CLIP-seq
MIRT1549851	hsa-miR-4516	CLIP-seq
MIRT1061833	hsa-miR-4640-5p	CLIP-seq
MIRT1061835	hsa-miR-4692	CLIP-seq
MIRT1549871	hsa-miR-4716-3p	CLIP-seq
MIRT1061836	hsa-miR-4726-5p	CLIP-seq
MIRT1549880	hsa-miR-4768-3p	CLIP-seq
MIRT1061862	hsa-miR-665	CLIP-seq
MIRT1061828	hsa-miR-1324	CLIP-seq
MIRT1061844	hsa-miR-147	CLIP-seq
MIRT2246589	hsa-miR-1470	CLIP-seq
MIRT1549770	hsa-miR-1909	CLIP-seq
MIRT1549771	hsa-miR-1913	CLIP-seq
MIRT1061846	hsa-miR-210	CLIP-seq
MIRT2246590	hsa-miR-3127-3p	CLIP-seq
MIRT1549786	hsa-miR-3144-5p	CLIP-seq
MIRT1549787	hsa-miR-3150b-3p	CLIP-seq
MIRT1549790	hsa-miR-3160-3p	CLIP-seq
MIRT1549797	hsa-miR-3191	CLIP-seq
MIRT1061848	hsa-miR-3194-5p	CLIP-seq
MIRT1549801	hsa-miR-324-3p	CLIP-seq
MIRT1061831	hsa-miR-3940-3p	CLIP-seq
MIRT1061852	hsa-miR-3943	CLIP-seq
MIRT1549831	hsa-miR-4323	CLIP-seq
MIRT1549847	hsa-miR-4487	CLIP-seq
MIRT2246591	hsa-miR-4488	CLIP-seq
MIRT1061832	hsa-miR-4514	CLIP-seq
MIRT1061833	hsa-miR-4640-5p	CLIP-seq
MIRT1549859	hsa-miR-4652-5p	CLIP-seq
MIRT1061875	hsa-miR-4656	CLIP-seq
MIRT1549862	hsa-miR-4663	CLIP-seq
MIRT2246592	hsa-miR-4689	CLIP-seq
MIRT1061835	hsa-miR-4692	CLIP-seq
MIRT2246593	hsa-miR-4697-5p	CLIP-seq
MIRT1061836	hsa-miR-4726-5p	CLIP-seq
MIRT1061876	hsa-miR-4731-5p	CLIP-seq
MIRT1549884	hsa-miR-4784	CLIP-seq
MIRT1061838	hsa-miR-491-5p	CLIP-seq
MIRT1549892	hsa-miR-558	CLIP-seq
MIRT1061860	hsa-miR-599	CLIP-seq
MIRT1549902	hsa-miR-637	CLIP-seq
MIRT1549902	hsa-miR-637	CLIP-seq
MIRT2429749	hsa-miR-10a	CLIP-seq
MIRT2429750	hsa-miR-10b	CLIP-seq
MIRT1549748	hsa-miR-1193	CLIP-seq
MIRT2429751	hsa-miR-1204	CLIP-seq
MIRT1549749	hsa-miR-1205	CLIP-seq
MIRT2429752	hsa-miR-1245b-3p	CLIP-seq
MIRT1549752	hsa-miR-1246	CLIP-seq
MIRT1549754	hsa-miR-1253	CLIP-seq
MIRT1061843	hsa-miR-125a-3p	CLIP-seq
MIRT2429753	hsa-miR-1266	CLIP-seq
MIRT2429754	hsa-miR-1270	CLIP-seq
MIRT2429755	hsa-miR-1273f	CLIP-seq
MIRT1549755	hsa-miR-1275	CLIP-seq
MIRT1549756	hsa-miR-1286	CLIP-seq
MIRT1549757	hsa-miR-1290	CLIP-seq
MIRT2429756	hsa-miR-1292	CLIP-seq
MIRT1549758	hsa-miR-1293	CLIP-seq
MIRT1061828	hsa-miR-1324	CLIP-seq
MIRT2429757	hsa-miR-133a	CLIP-seq
MIRT2429758	hsa-miR-133b	CLIP-seq
MIRT1549760	hsa-miR-141	CLIP-seq
MIRT2429759	hsa-miR-151-5p	CLIP-seq
MIRT2429760	hsa-miR-151b	CLIP-seq
MIRT1549762	hsa-miR-1587	CLIP-seq
MIRT2429761	hsa-miR-15a	CLIP-seq
MIRT2429762	hsa-miR-15b	CLIP-seq
MIRT2429763	hsa-miR-16	CLIP-seq
MIRT1549763	hsa-miR-181a	CLIP-seq
MIRT1549764	hsa-miR-181b	CLIP-seq
MIRT1549765	hsa-miR-181c	CLIP-seq
MIRT1549766	hsa-miR-181d	CLIP-seq
MIRT1549767	hsa-miR-1827	CLIP-seq
MIRT2429764	hsa-miR-185	CLIP-seq
MIRT1549769	hsa-miR-1908	CLIP-seq
MIRT1549771	hsa-miR-1913	CLIP-seq
MIRT1549773	hsa-miR-193a-5p	CLIP-seq
MIRT2429765	hsa-miR-195	CLIP-seq
MIRT1061845	hsa-miR-1972	CLIP-seq
MIRT1549777	hsa-miR-200a	CLIP-seq
MIRT2429766	hsa-miR-2052	CLIP-seq
MIRT1061846	hsa-miR-210	CLIP-seq
MIRT2429767	hsa-miR-2113	CLIP-seq
MIRT2429768	hsa-miR-219-1-3p	CLIP-seq
MIRT1922125	hsa-miR-2276	CLIP-seq
MIRT1549779	hsa-miR-2392	CLIP-seq
MIRT1549780	hsa-miR-24	CLIP-seq
MIRT1549781	hsa-miR-299-3p	CLIP-seq
MIRT2429769	hsa-miR-3121-5p	CLIP-seq
MIRT2429770	hsa-miR-3126-5p	CLIP-seq
MIRT1549782	hsa-miR-3127-5p	CLIP-seq
MIRT1549783	hsa-miR-3134	CLIP-seq
MIRT1549784	hsa-miR-3136-3p	CLIP-seq
MIRT1922126	hsa-miR-3140-3p	CLIP-seq
MIRT1061829	hsa-miR-3150a-3p	CLIP-seq
MIRT1549787	hsa-miR-3150b-3p	CLIP-seq
MIRT1549788	hsa-miR-3151	CLIP-seq
MIRT2429771	hsa-miR-3154	CLIP-seq
MIRT1549789	hsa-miR-3158-5p	CLIP-seq
MIRT1549791	hsa-miR-3166	CLIP-seq
MIRT1549792	hsa-miR-3167	CLIP-seq
MIRT1549793	hsa-miR-3170	CLIP-seq
MIRT1061830	hsa-miR-3175	CLIP-seq
MIRT1549794	hsa-miR-3179	CLIP-seq
MIRT1549795	hsa-miR-3182	CLIP-seq
MIRT1549796	hsa-miR-3189-5p	CLIP-seq
MIRT1549798	hsa-miR-3194-3p	CLIP-seq
MIRT1549799	hsa-miR-3195	CLIP-seq
MIRT1549800	hsa-miR-3199	CLIP-seq
MIRT2429772	hsa-miR-3202	CLIP-seq
MIRT1922127	hsa-miR-323-5p	CLIP-seq
MIRT1549801	hsa-miR-324-3p	CLIP-seq
MIRT1549803	hsa-miR-342-5p	CLIP-seq
MIRT1549804	hsa-miR-3611	CLIP-seq
MIRT1549806	hsa-miR-3622a-5p	CLIP-seq
MIRT2429773	hsa-miR-3647-3p	CLIP-seq
MIRT2429774	hsa-miR-3664-3p	CLIP-seq
MIRT2429775	hsa-miR-3675-5p	CLIP-seq
MIRT2429776	hsa-miR-3692	CLIP-seq
MIRT1549813	hsa-miR-371b-3p	CLIP-seq
MIRT1922129	hsa-miR-380	CLIP-seq
MIRT1549814	hsa-miR-3909	CLIP-seq
MIRT1922130	hsa-miR-3918	CLIP-seq
MIRT1922131	hsa-miR-3925-3p	CLIP-seq
MIRT1061851	hsa-miR-3934	CLIP-seq
MIRT1061831	hsa-miR-3940-3p	CLIP-seq
MIRT2429777	hsa-miR-409-3p	CLIP-seq
MIRT1549818	hsa-miR-410	CLIP-seq
MIRT2429778	hsa-miR-424	CLIP-seq
MIRT1061868	hsa-miR-4260	CLIP-seq
MIRT1549820	hsa-miR-4262	CLIP-seq
MIRT1549821	hsa-miR-4265	CLIP-seq
MIRT1549822	hsa-miR-4269	CLIP-seq
MIRT2429779	hsa-miR-4270	CLIP-seq
MIRT2429780	hsa-miR-4271	CLIP-seq
MIRT1549823	hsa-miR-4276	CLIP-seq
MIRT1061869	hsa-miR-4283	CLIP-seq
MIRT1549824	hsa-miR-4285	CLIP-seq
MIRT1549826	hsa-miR-4293	CLIP-seq
MIRT1549827	hsa-miR-4296	CLIP-seq
MIRT1549828	hsa-miR-4302	CLIP-seq
MIRT1549829	hsa-miR-4303	CLIP-seq
MIRT2429781	hsa-miR-4306	CLIP-seq
MIRT2429782	hsa-miR-4307	CLIP-seq
MIRT1061853	hsa-miR-4313	CLIP-seq
MIRT2429783	hsa-miR-4314	CLIP-seq
MIRT1061854	hsa-miR-4321	CLIP-seq
MIRT1549830	hsa-miR-4322	CLIP-seq
MIRT1549835	hsa-miR-4423-3p	CLIP-seq
MIRT1549836	hsa-miR-4426	CLIP-seq
MIRT1549837	hsa-miR-4433	CLIP-seq
MIRT1549838	hsa-miR-4434	CLIP-seq
MIRT1549839	hsa-miR-4437	CLIP-seq
MIRT2429784	hsa-miR-4441	CLIP-seq
MIRT1549840	hsa-miR-4447	CLIP-seq
MIRT1549842	hsa-miR-4455	CLIP-seq
MIRT1549843	hsa-miR-4459	CLIP-seq
MIRT2429785	hsa-miR-4471	CLIP-seq
MIRT1549845	hsa-miR-4472	CLIP-seq
MIRT1549846	hsa-miR-4483	CLIP-seq
MIRT1922132	hsa-miR-4495	CLIP-seq
MIRT1549848	hsa-miR-4501	CLIP-seq
MIRT2429786	hsa-miR-4504	CLIP-seq
MIRT2429787	hsa-miR-4506	CLIP-seq
MIRT2429788	hsa-miR-4508	CLIP-seq
MIRT1061832	hsa-miR-4514	CLIP-seq
MIRT1549850	hsa-miR-4515	CLIP-seq
MIRT1549851	hsa-miR-4516	CLIP-seq
MIRT2429789	hsa-miR-4518	CLIP-seq
MIRT2429790	hsa-miR-4524	CLIP-seq
MIRT2429791	hsa-miR-4531	CLIP-seq
MIRT1549855	hsa-miR-4532	CLIP-seq
MIRT1549856	hsa-miR-4534	CLIP-seq
MIRT1061833	hsa-miR-4640-5p	CLIP-seq
MIRT2429792	hsa-miR-4644	CLIP-seq
MIRT1922133	hsa-miR-4645-5p	CLIP-seq
MIRT1549858	hsa-miR-4647	CLIP-seq
MIRT1061856	hsa-miR-4650-5p	CLIP-seq
MIRT1061834	hsa-miR-4651	CLIP-seq
MIRT1549859	hsa-miR-4652-5p	CLIP-seq
MIRT1549861	hsa-miR-4662b	CLIP-seq
MIRT1549863	hsa-miR-4664-5p	CLIP-seq
MIRT1549864	hsa-miR-4665-5p	CLIP-seq
MIRT2429793	hsa-miR-4666-5p	CLIP-seq
MIRT1061857	hsa-miR-4667-3p	CLIP-seq
MIRT1549865	hsa-miR-4667-5p	CLIP-seq
MIRT1922134	hsa-miR-4668-3p	CLIP-seq
MIRT1922135	hsa-miR-4673	CLIP-seq
MIRT1549866	hsa-miR-4674	CLIP-seq
MIRT1549867	hsa-miR-4679	CLIP-seq
MIRT2429794	hsa-miR-4684-5p	CLIP-seq
MIRT1061835	hsa-miR-4692	CLIP-seq
MIRT1922136	hsa-miR-4694-3p	CLIP-seq
MIRT1549868	hsa-miR-4695-3p	CLIP-seq
MIRT1549869	hsa-miR-4695-5p	CLIP-seq
MIRT1549870	hsa-miR-4700-5p	CLIP-seq
MIRT2429795	hsa-miR-4703-3p	CLIP-seq
MIRT1549872	hsa-miR-4722-5p	CLIP-seq
MIRT2429796	hsa-miR-4725-3p	CLIP-seq
MIRT1061836	hsa-miR-4726-5p	CLIP-seq
MIRT2429797	hsa-miR-4735-5p	CLIP-seq
MIRT1549875	hsa-miR-4736	CLIP-seq
MIRT2429798	hsa-miR-4747-5p	CLIP-seq
MIRT1549877	hsa-miR-4758-3p	CLIP-seq
MIRT1549878	hsa-miR-4761-5p	CLIP-seq
MIRT1549879	hsa-miR-4762-3p	CLIP-seq
MIRT1549880	hsa-miR-4768-3p	CLIP-seq
MIRT1549881	hsa-miR-4768-5p	CLIP-seq
MIRT1549882	hsa-miR-4771	CLIP-seq
MIRT1922137	hsa-miR-4772-3p	CLIP-seq
MIRT1549883	hsa-miR-4775	CLIP-seq
MIRT1061837	hsa-miR-4776-3p	CLIP-seq
MIRT1061858	hsa-miR-4781-5p	CLIP-seq
MIRT1549884	hsa-miR-4784	CLIP-seq
MIRT1549885	hsa-miR-4800-5p	CLIP-seq
MIRT2429799	hsa-miR-4802-3p	CLIP-seq
MIRT1061877	hsa-miR-485-5p	CLIP-seq
MIRT1922138	hsa-miR-486-3p	CLIP-seq
MIRT2429800	hsa-miR-487b	CLIP-seq
MIRT1549887	hsa-miR-490-5p	CLIP-seq
MIRT1061838	hsa-miR-491-5p	CLIP-seq
MIRT2429801	hsa-miR-497	CLIP-seq
MIRT1549888	hsa-miR-499a-5p	CLIP-seq
MIRT2429802	hsa-miR-503	CLIP-seq
MIRT2429803	hsa-miR-513a-5p	CLIP-seq
MIRT1922139	hsa-miR-517a	CLIP-seq
MIRT1922140	hsa-miR-517c	CLIP-seq
MIRT1922141	hsa-miR-522	CLIP-seq
MIRT2429804	hsa-miR-542-3p	CLIP-seq
MIRT1549890	hsa-miR-542-5p	CLIP-seq
MIRT1922142	hsa-miR-544	CLIP-seq
MIRT2429805	hsa-miR-548u	CLIP-seq
MIRT1549893	hsa-miR-564	CLIP-seq
MIRT1549894	hsa-miR-566	CLIP-seq
MIRT2429806	hsa-miR-570	CLIP-seq
MIRT2429807	hsa-miR-571	CLIP-seq
MIRT1549895	hsa-miR-579	CLIP-seq
MIRT1061839	hsa-miR-583	CLIP-seq
MIRT1549896	hsa-miR-587	CLIP-seq
MIRT2429808	hsa-miR-591	CLIP-seq
MIRT2429809	hsa-miR-596	CLIP-seq
MIRT1549897	hsa-miR-602	CLIP-seq
MIRT1061840	hsa-miR-608	CLIP-seq
MIRT1549899	hsa-miR-609	CLIP-seq
MIRT2429810	hsa-miR-620	CLIP-seq
MIRT2429811	hsa-miR-624	CLIP-seq
MIRT2429812	hsa-miR-625	CLIP-seq
MIRT1922143	hsa-miR-626	CLIP-seq
MIRT1549900	hsa-miR-627	CLIP-seq
MIRT2429813	hsa-miR-629	CLIP-seq
MIRT1549902	hsa-miR-637	CLIP-seq
MIRT1061861	hsa-miR-640	CLIP-seq
MIRT2429814	hsa-miR-646	CLIP-seq
MIRT1549905	hsa-miR-659	CLIP-seq
MIRT1549906	hsa-miR-663	CLIP-seq
MIRT1922144	hsa-miR-668	CLIP-seq
MIRT1549908	hsa-miR-744	CLIP-seq
MIRT2429815	hsa-miR-758	CLIP-seq
MIRT2429816	hsa-miR-760	CLIP-seq
MIRT1061863	hsa-miR-764	CLIP-seq
MIRT1549909	hsa-miR-765	CLIP-seq
MIRT1922145	hsa-miR-766	CLIP-seq
MIRT1922146	hsa-miR-876-3p	CLIP-seq
MIRT1549911	hsa-miR-876-5p	CLIP-seq
MIRT1549913	hsa-miR-9	CLIP-seq
MIRT1549914	hsa-miR-933	CLIP-seq
MIRT1061841	hsa-miR-939	CLIP-seq
MIRT1061861	hsa-miR-640	CLIP-seq
MIRT1549748	hsa-miR-1193	CLIP-seq
MIRT2437707	hsa-miR-1202	CLIP-seq
MIRT2437708	hsa-miR-1226	CLIP-seq
MIRT1061828	hsa-miR-1324	CLIP-seq
MIRT1061844	hsa-miR-147	CLIP-seq
MIRT2437709	hsa-miR-151-3p	CLIP-seq
MIRT2429759	hsa-miR-151-5p	CLIP-seq
MIRT2429760	hsa-miR-151b	CLIP-seq
MIRT1549767	hsa-miR-1827	CLIP-seq
MIRT2429764	hsa-miR-185	CLIP-seq
MIRT1549769	hsa-miR-1908	CLIP-seq
MIRT2437710	hsa-miR-1912	CLIP-seq
MIRT1549772	hsa-miR-1915	CLIP-seq
MIRT1061845	hsa-miR-1972	CLIP-seq
MIRT1061846	hsa-miR-210	CLIP-seq
MIRT1549778	hsa-miR-2110	CLIP-seq
MIRT1549779	hsa-miR-2392	CLIP-seq
MIRT1549780	hsa-miR-24	CLIP-seq
MIRT2437711	hsa-miR-296-5p	CLIP-seq
MIRT2429770	hsa-miR-3126-5p	CLIP-seq
MIRT1549783	hsa-miR-3134	CLIP-seq
MIRT1549784	hsa-miR-3136-3p	CLIP-seq
MIRT1549786	hsa-miR-3144-5p	CLIP-seq
MIRT1061829	hsa-miR-3150a-3p	CLIP-seq
MIRT1549787	hsa-miR-3150b-3p	CLIP-seq
MIRT1061830	hsa-miR-3175	CLIP-seq
MIRT1549797	hsa-miR-3191	CLIP-seq
MIRT1061848	hsa-miR-3194-5p	CLIP-seq
MIRT2437712	hsa-miR-3197	CLIP-seq
MIRT1549800	hsa-miR-3199	CLIP-seq
MIRT2437713	hsa-miR-3617	CLIP-seq
MIRT1549806	hsa-miR-3622a-5p	CLIP-seq
MIRT2437714	hsa-miR-3622b-5p	CLIP-seq
MIRT1549809	hsa-miR-3677-5p	CLIP-seq
MIRT1549813	hsa-miR-371b-3p	CLIP-seq
MIRT1061831	hsa-miR-3940-3p	CLIP-seq
MIRT2437715	hsa-miR-3972	CLIP-seq
MIRT1549821	hsa-miR-4265	CLIP-seq
MIRT1549824	hsa-miR-4285	CLIP-seq
MIRT1549825	hsa-miR-4286	CLIP-seq
MIRT1549826	hsa-miR-4293	CLIP-seq
MIRT1549827	hsa-miR-4296	CLIP-seq
MIRT2437716	hsa-miR-4305	CLIP-seq
MIRT2429781	hsa-miR-4306	CLIP-seq
MIRT1061853	hsa-miR-4313	CLIP-seq
MIRT1549830	hsa-miR-4322	CLIP-seq
MIRT1549831	hsa-miR-4323	CLIP-seq
MIRT1549835	hsa-miR-4423-3p	CLIP-seq
MIRT1549836	hsa-miR-4426	CLIP-seq
MIRT1549837	hsa-miR-4433	CLIP-seq
MIRT1549838	hsa-miR-4434	CLIP-seq
MIRT1549839	hsa-miR-4437	CLIP-seq
MIRT1549840	hsa-miR-4447	CLIP-seq
MIRT1549843	hsa-miR-4459	CLIP-seq
MIRT1549844	hsa-miR-4460	CLIP-seq
MIRT2437717	hsa-miR-4462	CLIP-seq
MIRT2437718	hsa-miR-4463	CLIP-seq
MIRT1549845	hsa-miR-4472	CLIP-seq
MIRT1061871	hsa-miR-4492	CLIP-seq
MIRT1061872	hsa-miR-4498	CLIP-seq
MIRT2437719	hsa-miR-4499	CLIP-seq
MIRT1061832	hsa-miR-4514	CLIP-seq
MIRT1549850	hsa-miR-4515	CLIP-seq
MIRT1549851	hsa-miR-4516	CLIP-seq
MIRT1549854	hsa-miR-4523	CLIP-seq
MIRT1549855	hsa-miR-4532	CLIP-seq
MIRT1549856	hsa-miR-4534	CLIP-seq
MIRT1061833	hsa-miR-4640-5p	CLIP-seq
MIRT2429792	hsa-miR-4644	CLIP-seq
MIRT1549858	hsa-miR-4647	CLIP-seq
MIRT1061874	hsa-miR-4649-3p	CLIP-seq
MIRT1061856	hsa-miR-4650-5p	CLIP-seq
MIRT1549859	hsa-miR-4652-5p	CLIP-seq
MIRT1549861	hsa-miR-4662b	CLIP-seq
MIRT1549865	hsa-miR-4667-5p	CLIP-seq
MIRT1549866	hsa-miR-4674	CLIP-seq
MIRT1061835	hsa-miR-4692	CLIP-seq
MIRT1549870	hsa-miR-4700-5p	CLIP-seq
MIRT1549871	hsa-miR-4716-3p	CLIP-seq
MIRT1061836	hsa-miR-4726-5p	CLIP-seq
MIRT1549873	hsa-miR-4727-3p	CLIP-seq
MIRT2437720	hsa-miR-4733-3p	CLIP-seq
MIRT2437721	hsa-miR-4757-5p	CLIP-seq
MIRT1549880	hsa-miR-4768-3p	CLIP-seq
MIRT1549884	hsa-miR-4784	CLIP-seq
MIRT1549886	hsa-miR-490-3p	CLIP-seq
MIRT2429803	hsa-miR-513a-5p	CLIP-seq
MIRT1549890	hsa-miR-542-5p	CLIP-seq
MIRT1549892	hsa-miR-558	CLIP-seq
MIRT1549893	hsa-miR-564	CLIP-seq
MIRT2429809	hsa-miR-596	CLIP-seq
MIRT1061860	hsa-miR-599	CLIP-seq
MIRT1549897	hsa-miR-602	CLIP-seq
MIRT2437722	hsa-miR-641	CLIP-seq
MIRT1549906	hsa-miR-663	CLIP-seq
MIRT1549907	hsa-miR-711	CLIP-seq
MIRT1549908	hsa-miR-744	CLIP-seq
MIRT1061878	hsa-miR-762	CLIP-seq
MIRT1549909	hsa-miR-765	CLIP-seq
MIRT2437707	hsa-miR-1202	CLIP-seq
MIRT2437708	hsa-miR-1226	CLIP-seq
MIRT2437709	hsa-miR-151-3p	CLIP-seq
MIRT2437710	hsa-miR-1912	CLIP-seq
MIRT1549771	hsa-miR-1913	CLIP-seq
MIRT1061845	hsa-miR-1972	CLIP-seq
MIRT1061848	hsa-miR-3194-5p	CLIP-seq
MIRT1549801	hsa-miR-324-3p	CLIP-seq
MIRT2437714	hsa-miR-3622b-5p	CLIP-seq
MIRT2437715	hsa-miR-3972	CLIP-seq
MIRT1549825	hsa-miR-4286	CLIP-seq
MIRT2437716	hsa-miR-4305	CLIP-seq
MIRT1549840	hsa-miR-4447	CLIP-seq
MIRT2437718	hsa-miR-4463	CLIP-seq
MIRT1549845	hsa-miR-4472	CLIP-seq
MIRT2437719	hsa-miR-4499	CLIP-seq
MIRT1549855	hsa-miR-4532	CLIP-seq
MIRT1061856	hsa-miR-4650-5p	CLIP-seq
MIRT2437720	hsa-miR-4733-3p	CLIP-seq
MIRT2437721	hsa-miR-4757-5p	CLIP-seq
MIRT1549907	hsa-miR-711	CLIP-seq
MIRT2682647	hsa-miR-648	CLIP-seq

Show/Hide all (18)

Transcription factor	Regulation	Reference
ASCL1	Repression	20842449
CEBPA	Unknown	7659086
CTCF	Unknown	18458536;20966046;21536749;24725430
DDX5	Unknown	20966046
EGR1	Activation	8634146
EGR1	Unknown	10606246;11336542;9610618
EGR2	Unknown	9610618
HDAC5	Unknown	19666599
KHDRBS1	Activation	12849008
MBD1	Unknown	19666599
PLAG1	Activation	10646861;11284386;11888928;14695992;14712223
PLAG1	Unknown	23023303
PLAGL2	Activation	11888928
SP1	Activation	11327698
SP1	Unknown	10606246;11336542;9610618
SUZ12	Unknown	23962719
WT1	Repression	1323141;7535092;8634146
WT1	Unknown	10606246

Show/Hide all (71)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	ISS
GO:0001503	Process	Ossification	IEA
GO:0001649	Process	Osteoblast differentiation	IEA
GO:0001701	Process	In utero embryonic development	IEA
GO:0001701	Process	In utero embryonic development	ISS
GO:0001892	Process	Embryonic placenta development	IEA
GO:0001892	Process	Embryonic placenta development	ISS
GO:0005158	Function	Insulin receptor binding	IPI	12138094
GO:0005159	Function	Insulin-like growth factor receptor binding	IBA
GO:0005159	Function	Insulin-like growth factor receptor binding	IEA
GO:0005159	Function	Insulin-like growth factor receptor binding	IMP	2967174
GO:0005159	Function	Insulin-like growth factor receptor binding	TAS	1845984
GO:0005178	Function	Integrin binding	IDA	28873464
GO:0005179	Function	Hormone activity	IEA
GO:0005515	Function	Protein binding	IPI	10611375, 17850746, 18046459, 25416956, 31467278, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0006006	Process	Glucose metabolic process	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	NAS	12881524
GO:0008083	Function	Growth factor activity	IBA
GO:0008083	Function	Growth factor activity	IDA	11500939
GO:0008083	Function	Growth factor activity	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IC	11500939
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	28873464
GO:0008286	Process	Insulin receptor signaling pathway	IEA
GO:0008286	Process	Insulin receptor signaling pathway	ISS
GO:0008286	Process	Insulin receptor signaling pathway	TAS	1845984
GO:0009887	Process	Animal organ morphogenesis	IEA
GO:0030297	Function	Transmembrane receptor protein tyrosine kinase activator activity	IDA	11500939
GO:0030297	Function	Transmembrane receptor protein tyrosine kinase activator activity	IEA
GO:0031017	Process	Exocrine pancreas development	IEA
GO:0031093	Component	Platelet alpha granule lumen	TAS
GO:0040018	Process	Positive regulation of multicellular organism growth	IEA
GO:0042104	Process	Positive regulation of activated T cell proliferation	IBA
GO:0042104	Process	Positive regulation of activated T cell proliferation	IDA	15694994
GO:0043410	Process	Positive regulation of MAPK cascade	IBA
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	11500939
GO:0043539	Function	Protein serine/threonine kinase activator activity	IBA
GO:0043539	Function	Protein serine/threonine kinase activator activity	IEA
GO:0043539	Function	Protein serine/threonine kinase activator activity	ISS
GO:0045725	Process	Positive regulation of glycogen biosynthetic process	IEA
GO:0045725	Process	Positive regulation of glycogen biosynthetic process	ISS
GO:0045840	Process	Positive regulation of mitotic nuclear division	IDA	11500939
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046622	Process	Positive regulation of organ growth	IEA
GO:0046628	Process	Positive regulation of insulin receptor signaling pathway	IBA
GO:0046628	Process	Positive regulation of insulin receptor signaling pathway	IDA	11500939
GO:0048009	Process	Insulin-like growth factor receptor signaling pathway	IDA	7679099, 17827393
GO:0048009	Process	Insulin-like growth factor receptor signaling pathway	IEA
GO:0048009	Process	Insulin-like growth factor receptor signaling pathway	IPI	7541045
GO:0048018	Function	Receptor ligand activity	IEA
GO:0048018	Function	Receptor ligand activity	ISS
GO:0048633	Process	Positive regulation of skeletal muscle tissue growth	IEA
GO:0051146	Process	Striated muscle cell differentiation	IEA
GO:0051147	Process	Regulation of muscle cell differentiation	IBA
GO:0051147	Process	Regulation of muscle cell differentiation	IEA
GO:0051147	Process	Regulation of muscle cell differentiation	ISS
GO:0051148	Process	Negative regulation of muscle cell differentiation	IEA
GO:0051148	Process	Negative regulation of muscle cell differentiation	ISS
GO:0051781	Process	Positive regulation of cell division	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	11500939
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	ISS
GO:0060669	Process	Embryonic placenta morphogenesis	IEA
GO:0060669	Process	Embryonic placenta morphogenesis	ISS
GO:0071514	Process	Genomic imprinting	TAS	8968759
GO:1905564	Process	Positive regulation of vascular endothelial cell proliferation	IBA

MIM	HGNC	e!Ensembl
147470	5466	ENSG00000167244

P01344

Protein name

Insulin-like growth factor 2 (Insulin-like growth factor II) (IGF-II) (Somatomedin-A) (T3M-11-derived growth factor) [Cleaved into: Insulin-like growth factor II Ala-25 Del; Preptin]

Protein function

The insulin-like growth factors possess growth-promoting activity (By similarity). Major fetal growth hormone in mammals. Plays a key role in regulating fetoplacental development. IGF2 is influenced by placental lactogen. Also involved in tissue

PDB

1IGL , 2L29 , 2V5P , 3E4Z , 3KR3 , 5L3L , 5L3M , 5L3N , 6UM2 , 6VWG , 6VWI , 8U4C , 8U4E , 8VJB , 8VJC

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00049	Insulin	30 → 62	Insulin/IGF/Relaxin family	Domain
PF00049	Insulin	54 → 84	Insulin/IGF/Relaxin family	Domain
PF08365	IGF2_C	112 → 166	Insulin-like growth factor II E-peptide	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in heart, placenta, lung, liver, muscle, kidney, tongue, limb, eye and pancreas. {ECO:0000269|PubMed:16531418}.

Sequence

MGIPMGKSMLVLLTFLAFASCCIAAYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVS
RRSRGIVEECCFRSCDLALLETYCATPAKSERDVSTPPTVLPDNFPRYPVGKFFQYDTWK
QSTQRLRRGLPALLRARRGHVLAKELEAFREAKRHRPLIALPTQDPAHGGAPPEMASNRK

Sequence length

180

Interactions

View interactions

	KEGG		Reactome
	MAPK signaling pathway Ras signaling pathway Hormone signaling PI3K-Akt signaling pathway Pathways in cancer Proteoglycans in cancer Hepatocellular carcinoma		Platelet degranulation Signaling by Type 1 Insulin-like Growth Factor 1 Receptor (IGF1R) IRS-related events triggered by IGF1R SHC-related events triggered by IGF1R Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (6)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Beckwith-Wiedemann syndrome	Likely pathogenic	rs1858937359	RCV002491857	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Colorectal cancer	Pathogenic	rs1858717597	RCV001293830	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
IGF2-related disorder	Pathogenic	rs2495589617	RCV003394389	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Silver-Russell syndrome 1	Pathogenic; Likely pathogenic	rs1064794050, rs1114167321, rs1858937359	RCV000491853 RCV000490875 RCV002491857	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Silver-Russell syndrome 3	Likely pathogenic; Pathogenic	rs142012621, rs2495591068, rs869320620, rs2495590067, rs2495576486, rs2495572126, rs2495576425, rs1858936079, rs1858937182, rs1858932834, rs1858779370, rs1858937359	RCV002226891 RCV002290217 RCV000186560 RCV003148454 RCV003223520 View all (8 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Wilms tumor 1	Likely pathogenic	rs1858937359	RCV002491857	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (49)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ALZHEIMERS DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANEMIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANKYLOSING SPONDYLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATHEROSCLEROSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISTIC DISORDER	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE THYROID DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BECKWITH-WIEDEMANN SYNDROME DUE TO IMPRINTING DEFECT OF 11P15	—	Disgenet, Orphanet Disgenet, Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BONE DISEASES, DEVELOPMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CELIAC DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COGNITION DISORDERS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLONIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMMON VARIABLE IMMUNODEFICIENCY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DELIRIUM, DEMENTIA, AMNESTIC, COGNITIVE DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DESBUQUOIS SYNDROME	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DISORDER OF PREGNANCY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GROWTH DISORDERS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEMIHYPERPLASIA, ISOLATED	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATOBLASTOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOGLYCEMIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSULIN-LIKE GROWTH FACTOR II POLYMORPHISM	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE IDIOPATHIC ARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEWY BODY DISEASE	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MEMORY DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHABDOMYOSARCOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RUSSELL-SILVER SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SILVER-RUSSELL SYNDROME	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SILVER-RUSSELL SYNDROME DUE TO 11P15 MICRODUPLICATION	—	Disgenet, Orphanet Disgenet, Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SILVER-RUSSELL SYNDROME DUE TO A POINT MUTATION	—	Disgenet, Orphanet Disgenet, Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SILVER-RUSSELL SYNDROME DUE TO AN IMPRINTING DEFECT OF 11P15	—	Disgenet, Orphanet Disgenet, Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
WILMS TUMOR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (606)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Confusional Senile Dementia	Senile Dementia	CTD_human_DG	15750215		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	12165460		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	12804639		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	11398994, 11536368, 12412161, 15514114, 1713573, 17399767, 21668571, 22159423, 22392079, 8855837		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	10205209, 1713573		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	21380782		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	11536368, 12584565		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	10646861, 10963127, 14996863, 15057734, 15490195, 15585629, 19218281, 20682317, 21062411, 22645077, 22800756, 24194259, 25110432, 28877067, 29682767, 7911125, 9694575 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	LHGDN	18611974		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	14996863, 22645077		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	22121898		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenomatous Polyps	Adenomatous Polyposis	BEFREE	21068132		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal Cancer	Adrenal Cancer	BEFREE	15949953		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal Cortical Adenoma	Adrenocortical adenoma	BEFREE	27535174, 31378849, 7621447		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal Gland Neoplasms	Adrenal neoplasia	BEFREE	26400872, 29682767, 7531713, 7717451		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	2405002, 26400872, 3029761, 7964281, 8370710		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	BEFREE	10425444, 10965887, 11889182, 15241731, 15853821, 16001332, 18611974, 21386792, 23028800, 23093492, 25089899, 26131713, 26400872, 27387247, 27535174 View all (7 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	12547710, 31378849, 36169175	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	15613424, 17280861, 21521927, 25089899, 26400872, 30838516, 32373071, 32791542, 38068896, 40038716	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	LHGDN	18611974		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	CTD_human_DG	21521927, 23417626		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	21874045, 24252690, 8957451		★★★★★ ★☆☆☆☆ Found in Text Mining only
Age-Related Memory Disorders	Age-Related Memory Disorders	CTD_human_DG	21270887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	12547710, 16556722, 19218281, 19500768, 19519204, 21208995, 21521927, 22800756, 23074235, 24890943, 25089899, 27535174, 28277340, 28672049, 29112114, 30069455, 31378849 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aicardi Syndrome	Aicardi syndrome	Pubtator	26400872	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alveolar rhabdomyosarcoma	Alveolar Rhabdomyosarcoma	BEFREE	24173021		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	26627638, 37438770	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Alzheimer Disease, Early Onset	Alzheimer disease	CTD_human_DG	15750215		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	CTD_human_DG	15750215		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	CTD_human_DG	15750215		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease, Focal Onset	Alzheimer disease	CTD_human_DG	15750215		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	27180807, 29113829		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	2466561, 25971976, 9205065		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	CTD_human_DG	12090760		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Angiofibroma	Angiofibroma	LHGDN	12605037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Angiofibroma	Angiofibroma	BEFREE	8583852		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anodontia	Anodontia	Pubtator	15192314	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	24769899		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety disorder	Pubtator	27023171, 29225348, 34572069	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	30905741		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	30905741		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	27708216		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	12547710, 16556722, 19218281, 19500768, 19519204, 21208995, 21521927, 22800756, 23074235, 24890943, 25089899, 27535174, 28277340, 28672049, 29112114, 30069455, 31378849 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	14501587, 23257688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	35641033	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asphyxia Neonatorum	Postnatal asphyxia	BEFREE	18060947		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	8242555		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	CTD_human_DG	11726660		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	BEFREE	14501587, 23257688		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	LHGDN	17635080		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	27535767	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	28751869		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	28751869, 29217683		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	CTD_human_DG	17547689		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	Pubtator	22395465	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Azoospermia	Azoospermia	Pubtator	27535712	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	29480850		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	16339295		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	16339295	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Beckwith-Wiedemann Syndrome	Beckwith-Wiedemann Syndrome	BEFREE	10102049, 10220444, 10393948, 10402475, 10424811, 10601037, 10779549, 10820361, 10857747, 11106355, 11441340, 11935324, 12510981, 12621455, 1356784 View all (58 more)		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Beckwith-Wiedemann Syndrome	Beckwith-Wiedemann Syndrome	GENOMICS_ENGLAND_DG	17325026, 26154720		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Beckwith-Wiedemann Syndrome	Beckwith-Wiedemann Syndrome	CTD_human_DG	8252039, 9349812		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Beckwith-Wiedemann syndrome due to imprinting defect of 11p15	Beckwith-Wiedemann Syndrome	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Benign Meningioma	Benign Meningioma	BEFREE	8242555		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	29523298, 30069455, 9253334, 9589681		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	11297606, 19513555, 29129118, 7525636, 9215294		★★★★★ ★☆☆☆☆ Found in Text Mining only
beta Thalassemia	beta Thalassemia	BEFREE	22983591		★★★★★ ★☆☆☆☆ Found in Text Mining only
beta Thalassemia	Beta thalassemia	Pubtator	22983591	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
beta^+^ Thalassemia	beta Thalassemia	BEFREE	22983591		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bilateral Wilms Tumor	Wilms tumor	CTD_human_DG	8252039		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	18006818, 21162716, 28286973, 28295307, 28484844, 28882129		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	LHGDN	18006818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	9558368		★★★★★ ★☆☆☆☆ Found in Text Mining only
Body Weight	Body weight	Pubtator	11223541	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases, Developmental	Bone Disease	CTD_human_DG	9349812		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Neoplasms	Brain Neoplasms	LHGDN	12125963		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	1656313, 8242555		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Stem Neoplasms	Brain stem neoplasms	Pubtator	2547840	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10226795, 10229198, 10619489, 10931743, 12113587, 12550081, 1310798, 1421420, 1421422, 1421423, 15026620, 15756268, 16037384, 1651793, 1656243 View all (36 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Diseases	Breast Diseases	BEFREE	8842730		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	10619489, 11223541, 12113587, 16393696, 17348446, 18337447, 18428028, 18541649, 19724140, 20089431, 20347606, 20422427, 20677165, 21245875, 21410323 View all (11 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bulimia	Bulimia	BEFREE	16330588		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bulimia Nervosa	Bulimia	BEFREE	16330588		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cakut	Congenital anomalies of the kidney and urinary tract	Pubtator	39237660	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cap Myopathy	Cap myopathy	Pubtator	29453410	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	10646893, 11278392, 12531883, 20682317, 24298054, 25292066, 27366946, 8876210, 9624415, 9660813	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	12086849, 12142546, 18604514, 19218281, 2285595, 24066089, 28877067, 7627387, 7911125, 8370710, 8570220, 9851669		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	10779553, 34516353, 7639583	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	11336542, 11549587, 12531883, 12804776, 12824919, 15736456, 15991281, 16094705, 17006932, 17690210, 18358696, 18803353, 21548981, 22684773, 22994732 View all (16 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	12618883	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	18006818, 21162716, 22500655, 28286973, 28295307, 28484844, 28729397, 28882129, 7589512		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	10974650, 12142546, 12584565, 17255263, 23257688, 25292066, 25884481, 27582487, 30803359, 7499276		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	15890779, 16603642, 20404007, 21109978, 21422097, 23551967, 32045670	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	22627630, 33827033, 34326314	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	24485233	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	10690526, 12193537, 15661221, 16603642, 16859738, 17569086, 17974952, 19477633, 21109978, 21422097, 23551967, 23677070, 23877403, 24727326, 24872956 View all (6 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinosarcoma	BEFREE	10779632		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinoma	Pubtator	26666605, 29455465	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic	Hypertrophic cardiomyopathy	Pubtator	24183960	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Abnormalities	Cardiovascular Abnormalities	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	14501587, 23257688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	25923461, 32150081	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Atherosclerosis	Carotid Atherosclerosis	BEFREE	29724293		★★★★★ ★☆☆☆☆ Found in Text Mining only
CATSHL syndrome	Catshl syndrome	Pubtator	23572028	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Central Nervous System Neoplasms	Central nervous system neoplasm	Pubtator	34417833	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Central Precocious Puberty	Central Precocious Puberty	BEFREE	30249230		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	40133811	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	14599874, 17709267, 23464477, 23775149, 8570220		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	23775149		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	11997082, 14599874, 17709267, 23775149, 30949792		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	22878902		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	21874045, 24252690, 8957451		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	12618883, 21548981	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	17550320	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	29716918, 9609998		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangitis Sclerosing	Sclerosing cholangitis	Pubtator	30344796	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholesteatoma	Cholesteatoma	Pubtator	33627146	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	32314747	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	LHGDN	17556377		★★★★★ ★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	7866996, 9062579, 9244352		★★★★★ ★☆☆☆☆ Found in Text Mining only
Choroid Plexus Papilloma	Choroid Plexus Papilloma	BEFREE	30249230		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	17488802	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic lung disease	Lung Diseases	BEFREE	29702590		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	15380337		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	11549587, 1847351, 18803353, 22902352, 3180092		★★★★★ ★☆☆☆☆ Found in Text Mining only
Clear cell sarcoma of kidney	Sarcoma Of Kidney	BEFREE	13679437, 9385942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Clear Cell Sarcoma of Soft Tissue	Sarcoma	LHGDN	13679437		★★★★★ ★☆☆☆☆ Found in Text Mining only
Clear Cell Sarcoma of Soft Tissue	Sarcoma	BEFREE	22406360		★★★★★ ★☆☆☆☆ Found in Text Mining only
Clinodactyly	Clinodactyly	BEFREE	19632365		★★★★★ ★☆☆☆☆ Found in Text Mining only
Clinodactyly of fingers	Clinodactyly	BEFREE	19632365		★★★★★ ★☆☆☆☆ Found in Text Mining only
Clinodactyly of fingers	Clinodactyly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Clinodactyly of the 5th finger	Camptodactyly of fingers	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Clumsiness - motor delay	Motor delay	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	CTD_human_DG	21270887		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon Carcinoma	Colon Carcinoma	BEFREE	10337989, 15521051, 17325430, 17382534, 18541649, 19549920, 20682317, 22377707, 22565227, 23257688, 23421499, 26407907, 26445041, 28534511, 3779638, 7531153, 8765974 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Diseases	Colonic disease	Pubtator	22159423, 30073757	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	10205209, 12412161, 22392079, 22895193	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Neoplasms	Colonic Neoplasms	CTD_human_DG	15057734		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Neoplasms	Colonic Neoplasms	BEFREE	1713573, 22895193		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Carcinoma	Colorectal Cancer	BEFREE	10398115, 10891541, 11053988, 11120891, 11340379, 12412161, 12438232, 12637750, 14996863, 15192314, 15731405, 15935984, 16357124, 16432831, 16525660 View all (34 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	CTD_human_DG	12637750		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	10226796, 1399116, 15455346, 15585629, 1975564, 20682317, 23171475, 28729397		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	11857296, 1558785, 16603642, 17474983, 18365005, 18541649, 18834226, 19957330, 20682317, 21037082, 21978709, 22377707, 22565227, 25110432, 25167802 View all (12 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	12412161, 18842999, 22159423, 22354904, 29486770	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	12579496, 12637750, 14996863, 16525660, 18619647		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	CTD_human_DG	12637750		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	15192314	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Complete hydatidiform mole	Complete Hydatidiform Mole	BEFREE	14605814, 7866996		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital adrenal hyperplasia due to 21 hydroxylase deficiency	Congenital adrenal hyperplasia	BEFREE	19039234		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	8968759		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	29716918		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital exomphalos	Congenital Exomphalos	BEFREE	10424811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital hemihypertrophy	Congenital Hemihypertrophy	ORPHANET_DG	18159214		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital hemihypertrophy	Congenital Hemihypertrophy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Hyperinsulinism	Congenital hyperinsulinism	Pubtator	18931647	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Mesoblastic Nephroma	Congenital Mesoblastic Nephroma	BEFREE	12165445, 17639583, 8634785		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital omphalocele	Congenital omphalocele	BEFREE	10424811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital omphalocele	Congenital omphalocele	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital posterior urethral valves	Congenital Posterior Urethral Valves	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital urethral valve	Congenital Malformation Of The Urinary System	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	12505877, 29574782		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conn Adenoma	Conn Adenoma	BEFREE	8370710		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	9205056		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	17488802		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	17488802		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	32150081	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	17488802	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	14749349, 17488802		★★★★★ ★☆☆☆☆ Found in Text Mining only
Costello Syndrome	Costello syndrome	Pubtator	26572961	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Costello syndrome (disorder)	Costello syndrome	BEFREE	26572961		★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniopharyngioma	Craniopharyngioma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cushing Syndrome	Cushing`s Syndrome	BEFREE	7911125		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cushing's symphalangism	Proximal symphalangism	Pubtator	31262327	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutaneous Fibrous Histiocytoma	Fibrous Histiocytoma	BEFREE	1311795		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	20483645		★★★★★ ★☆☆☆☆ Found in Text Mining only
De Lange Syndrome	De lange syndrome	Pubtator	34827619	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	17187661, 26015264, 7738951		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	26993302		★★★★★ ★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating diseases	Pubtator	29596844	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	30617637, 31554266		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	34721734	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Desmoplastic Small Round Cell Tumor	Desmoplastic small round cell tumor	Pubtator	32703985	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Development Disorder	BEFREE	29244185, 9285792		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	12794058, 18728168, 1944595, 22770937, 25971976		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	18550048, 31194812	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	21926269, 22392079, 22893718, 24934635	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	31424259	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	12794058, 18728168, 1944595, 22770937, 25971976, 29889083, 30536889		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	17488802, 26273670, 28903990, 32171244	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	11855150, 15699493, 22069105, 23935095, 25422107, 26073034, 26220792, 26273670, 26782299	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	15181035, 25922844, 25923461, 28838971, 37935955	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	20929508, 23935095	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	11115836, 11855150, 12794058, 15008838, 22770937, 31826866, 7672495, 8816980, 9588457, 9709972		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	14715866, 17476475, 19148120, 20929508, 22770937, 23757053, 25922844, 27409167, 28570978, 31182468		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	28838971		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	BEFREE	28735866		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	20929508	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	20929508, 22770937, 31182468		★★★★★ ★☆☆☆☆ Found in Text Mining only
Disorders of Sex Development	Disorders of sex development	Pubtator	22801570	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dupuytren Contracture	Dupuytren contracture	Pubtator	26018562	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	BEFREE	28736533, 29249625, 9768660		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysmorphic features	Dysmorphic Features	BEFREE	26154720		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysmorphism	Dysmorphism	BEFREE	25423083		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dystonia 18	Dystonia	Pubtator	17289909	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Early infantile epileptic encephalopathy with suppression bursts	Epileptic Encephalopathy	BEFREE	12588801		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eating Disorders	Eating Disorders	BEFREE	16330588		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eclampsia	Eclampsia	BEFREE	11969341		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ectodermal Dysplasia	Ectodermal dysplasia	Pubtator	38068896	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ectrodactyly	Ectrodactyly	BEFREE	28489339		★★★★★ ★☆☆☆☆ Found in Text Mining only
Embryonal Neoplasm	Embryonal Neoplasm	BEFREE	11008203, 21174059, 7728748, 7794794, 8298652, 8618347, 9144243, 9771969		★★★★★ ★☆☆☆☆ Found in Text Mining only
Embryonal Rhabdomyosarcoma	Embryonal Rhabdomyosarcoma	BEFREE	20019182, 26056800, 26572961, 8116575		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial adenocarcinoma	Endometrial Adenocarcinoma	BEFREE	17399767		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	10779632, 17598937, 7523316		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial Hyperplasia	BEFREE	17399767		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	17399767, 21078522, 37393293	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	BEFREE	9856569		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	19055724	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	35459174	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	36508036	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ependymoma	Ependymoma	BEFREE	18478565		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	10690526, 15661221, 16603642, 16859738, 17974952, 19477633, 21109978, 21422097, 23551967, 26751131, 30672383		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	11053988, 17310846, 21668571, 24599933, 29604392, 8945613		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	11053988, 17310846, 21668571, 24599933, 29604392, 8945613		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	LHGDN	17310846		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	29207103, 33061807	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	29724293		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	8545106		★★★★★ ★☆☆☆☆ Found in Text Mining only
Exophthalmos	Proptosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	CTD_human_DG	15750215		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	20403354		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	16344856, 30277114	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	30277114		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibroadenoma	Fibroadenoma	BEFREE	26676988		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	1358435, 1979007, 20651370, 2208134, 23485847, 25015674, 28324020, 29891843, 3409868, 7684390, 7902208, 8821886, 9184179		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	10931103		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	28650518		★★★★★ ★☆☆☆☆ Found in Text Mining only
Folic Acid Deficiency	Folic Acid Deficiency	BEFREE	30240347		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fragile X Syndrome	Fragile X Syndrome	BEFREE	27643697, 28352664		★★★★★ ★☆☆☆☆ Found in Text Mining only
Frontal bossing	Frontal bossing	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	16443739	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	9570380		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	18372285, 22770876		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	18372285, 19407853, 22658485, 22770876, 24133624, 25987131	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Germ cell tumor	Tumor	BEFREE	10189147, 11585765, 16001432, 16721595, 8021956, 9112575		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gestational trophoblastic disease	Hydatidiform mole	BEFREE	12648595, 8073225		★★★★★ ★☆☆☆☆ Found in Text Mining only
Giant Cell Tumor of Tendon Sheath	Giant cell tumor of tendon sheath	Pubtator	19407853	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	33746571	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	14614750	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	14614750		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	17360667, 25719943	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	21613208, 30231881, 3211366, 8242555		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	21613208, 3211366		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	10337989, 17541939, 30231881, 3211366, 8138595, 8968084, 9777949		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	22168049, 27560636	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease IIIC	Glycogen storage disease	Pubtator	39896800	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gonadoblastoma	Gonadoblastoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Growth Disorders	Growth disorder	Pubtator	18365005, 21282187	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GROWTH RESTRICTION, SEVERE, WITH DISTINCTIVE FACIES	GROWTH RESTRICTION, SEVERE, WITH DISTINCTIVE FACIES	GENOMICS_ENGLAND_DG	26154720		★★★★★ ★☆☆☆☆ Found in Text Mining only
GROWTH RESTRICTION, SEVERE, WITH DISTINCTIVE FACIES	GROWTH RESTRICTION, SEVERE, WITH DISTINCTIVE FACIES	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
GROWTH RESTRICTION, SEVERE, WITH DISTINCTIVE FACIES	GROWTH RESTRICTION, SEVERE, WITH DISTINCTIVE FACIES	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hamartoma	Hamartoma	BEFREE	11441340		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	10597307, 23482325		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	29136764		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	12505877, 29574782		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	21546606	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangioma	Hemangioma	BEFREE	12032304, 15706404, 18287964, 23047069, 24968760, 26496499, 30867686		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangioma	Hemangioma	LHGDN	18287964		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangioma capillary infantile	Capillary infantile hemangioma	Pubtator	15706404, 18287964, 26496499	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
hemangiopericytoma	Hemangiopericytoma	BEFREE	10468998, 19383775, 2584352, 8760024, 9236865		★★★★★ ★☆☆☆☆ Found in Text Mining only
HEMIHYPERPLASIA, ISOLATED	Hemihyperplasia	ORPHANET_DG	18159214		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatitis B	Hepatitis b	Pubtator	21548981	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	9443091	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	29763915	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	10404060, 10732739, 10789725, 11021841, 11597130, 14695992, 17072986, 19034281, 19200579, 22401581, 7543440, 7624139, 7728748, 8402661, 9462704, 9713365 View all (1 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatoblastoma	Hepatoblastoma	Pubtator	10732739, 10789725, 11021841, 17006932, 17072986, 18271875, 19034281, 22401581, 24373183, 32390604, 37932266, 38285887	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatoblastoma	Hepatoblastoma	LHGDN	14695992		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatoblastoma	Hepatoblastoma	CTD_human_DG	23958494		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatoblastoma	Hepatoblastoma	HPO_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	8876210	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Melanoma	Hereditary cutaneous melanoma	BEFREE	20483645		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Nonpolyposis Colorectal Cancer	Colorectal Cancer	BEFREE	22121898		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung Disease	BEFREE	30073757		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung disease	Pubtator	30073757	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Histiocytoma	Histiocytoma	BEFREE	1311795		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydatidiform Mole	Hydatidiform Mole	BEFREE	12648595		★★★★★ ★☆☆☆☆ Found in Text Mining only
HYDATIDIFORM MOLE, RECURRENT, 1	Hydatidiform Mole	BEFREE	12648595		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperaldosteronism	Hyperaldosteronism	Pubtator	32791542	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperandrogenism	Hyperandrogenism	BEFREE	15181035, 28111236		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperandrogenism	Hyperandrogenism	Pubtator	15181035	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	19560381, 20929508		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	20929508	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	26840070	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	1281841, 19752219		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	32150081, 32171244, 36862882	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	11935324, 20057340, 29574782, 29724293		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	11113012		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	10468998, 10931103, 1281841, 1311795, 1718747, 18552458, 19383775, 20527023, 2159026, 2170553, 2584352, 26073062, 2646313, 27585487, 28012446 View all (8 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypoglycemia	Hypoglycemia	Pubtator	1281841, 15575249, 1697608, 18552458, 19407853, 22646060, 7685912	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypoglycemia	Hypoglycemia	CTD_human_DG	3185662		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypospadias	Hypospadias	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	35641033	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ichthyosis Congenita II	Ichthyosis Congenita	BEFREE	20082469		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ichthyosis, X-Linked	Ichthyosis	BEFREE	22770876		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	31765403	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	24778346, 28352664		★★★★★ ★☆☆☆☆ Found in Text Mining only
Infantile hemangioma	Hemangioma	BEFREE	15706404, 18287964, 26496499, 30867686		★★★★★ ★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	27535712	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	15181035, 22646060, 25923461	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	31517621	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
insulinoma	Insulinoma	BEFREE	19502451, 22456267, 27667266, 30021864		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal Neoplasms	BEFREE	16357124		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Meningioma	Intracranial Meningioma	BEFREE	8242555		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	23775149		★★★★★ ★☆☆☆☆ Found in Text Mining only
Islet Cell Tumor	Islet Cell Tumor	BEFREE	19383775, 24080445, 2584352, 28012446, 31328061		★★★★★ ★☆☆☆☆ Found in Text Mining only
Isolated somatotropin deficiency	Isolated Somatotropin Deficiency	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	21625944		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	34326314	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	BEFREE	9205056		★★★★★ ★☆☆☆☆ Found in Text Mining only
Klippel-Trenaunay-Weber Syndrome	Klippel-Trenaunay-Weber Syndrome	BEFREE	10712200		★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	16111804		★★★★★ ★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	11113012		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leigh Disease	Leigh syndrome	Pubtator	36549505	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	18439583, 28324020	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leiomyosarcoma	Leiomyosarcoma	BEFREE	1358435, 2208134, 2248982, 3185662, 3409868, 9184179		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	3409868, 9184179	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	15753088	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	9070302		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	15645136, 9070302		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelomonocytic, Chronic	Myelomonocytic Leukemia	BEFREE	15645136		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy Body Disease	BEFREE	19276553		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lewy Body Disease	Lewy Body Disease	CTD_human_DG	19276553		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lewy Body Disease	Lewy body disease	Pubtator	26627638	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	15970649, 21347719		★★★★★ ★☆☆☆☆ Found in Text Mining only
liposarcoma	Liposarcoma	BEFREE	3779638		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	10221816, 10779553, 10949925, 11549587, 12118381, 12124323, 12531883, 12804776, 14595760, 15342387, 15736456, 16094705, 16697535, 16750516, 16857788 View all (55 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	12532445, 16092956		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	12804776, 16750516, 16857788, 18035699, 18350600, 18358696		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	11549587, 16094705, 1847351, 18803353, 22902352, 3180092, 9610618		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	12618883, 9610618	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	CTD_human_DG	12127304		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver neoplasms	Liver neoplasms	BEFREE	2170553, 27614046, 9603916, 9806456		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Diseases	Lung disease	Pubtator	10077643, 8626706	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	9657575	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	12142546, 1320623, 20015958, 22347413, 25292066, 26837769, 30803359, 7499276	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	12584565, 1372941		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	34646335	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphangioleiomyomatosis	Lymphangiomyomatosis	BEFREE	11523698, 29758070		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	11020056, 19737423, 23934455, 25292066, 31856144, 32004974	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	15010842, 16434968		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	18980977	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphopenia	Lymphopenia	BEFREE	12794058		★★★★★ ★☆☆☆☆ Found in Text Mining only
Macroglossia	Macroglossia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	30946360	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Fibrous Histiocytoma	Malignant Histiocytoma	BEFREE	24804818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	23482325		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	BEFREE	22555177		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of adrenal cortex	Adrenocortical carcinoma	BEFREE	16001332, 23028800, 27387247		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10226795, 10229198, 10619489, 10931743, 12113587, 12550081, 1310798, 1421420, 1421422, 1421423, 15026620, 15756268, 16037384, 1651793, 1656243 View all (37 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	17598937, 7523316		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	11053988, 17310846, 21668571, 24599933, 28186102, 29604392, 8945613		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	CTD_human_DG	12127304		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	1707028, 2174934, 3180092, 9620554		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	10974650, 12142546, 12584565, 17255263, 17598937, 20440268, 23257688, 25292066, 25884481, 27582487, 30803359, 7499276, 8622877		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	15970649, 21347719		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	10690526, 15661221, 16603642, 17569086, 19956846, 21109978, 21422097, 23677070, 23877403, 24727326, 24872956, 24932685, 28829218, 8644850, 9669031		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	19064563, 25183049, 27895308, 28420208, 30958159, 31261900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	10218964, 11597555, 12550081, 12610512, 14666684, 14712493, 16018936, 16397247, 18563715, 18701505, 19016246, 22293856, 23319492, 23890537, 24615121 View all (12 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	11677116, 16264263, 21268128, 22447362, 28871451, 31361067		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	21123448, 30513575		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	10944603, 18006818, 21162716, 28286973, 28295307, 28484844, 28882129		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10077643, 10197590, 10220444, 10369866, 10393948, 10446221, 10463576, 10602511, 10857553, 11053988, 11717330, 12118381, 12193537, 12550081, 12621455 View all (101 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	14599874, 17709267, 23775149		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	10226796, 16603642, 17325430, 17382534, 18541649, 19549920, 20682317, 22377707, 22565227, 23257688, 23421499, 26407907, 26445041, 28534511, 8612513		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	CTD_human_DG	15057734		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	20089431, 30016152		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	16037384, 17369847, 18428028, 18719053		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	1651793, 20422427, 2152773, 27780718, 3180080, 7757999, 8636375, 8932875, 9177406		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	22555177		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	21874045, 24252690, 8957451		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanocytic nevus	Melanocytic nevus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	18297687, 20483645, 22406360		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	18297687		★★★★★ ★☆☆☆☆ Found in Text Mining only
Memory Disorders	Memory Disorders	CTD_human_DG	21270887		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Meningioma	Meningioma	BEFREE	10738131, 11477136, 1656313, 1779982, 20386868, 8242555, 9205065		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	12163391, 20386868, 36809604	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningomyelocele	Meningomyelocele	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	30617637, 31554266		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	14671408		★★★★★ ★☆☆☆☆ Found in Text Mining only
MENTAL RETARDATION, X-LINKED, SNYDER-ROBINSON TYPE	Mental retardation	BEFREE	18365005		★★★★★ ★☆☆☆☆ Found in Text Mining only
MENTAL RETARDATION, X-LINKED, SNYDER-ROBINSON TYPE	Mental retardation	GENOMICS_ENGLAND_DG	26154720		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	37108544	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	9479554		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	12612292, 37108544	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	23844573, 25269528		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	27560636	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	34093434	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	11793026, 14749349, 17560154, 17658692, 19560381, 24956249, 28916632		★★★★★ ★☆☆☆☆ Found in Text Mining only
Micrognathism	Micrognathism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Mild Mental Retardation	Mental retardation	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	CTD_human_DG	18539642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	31852928	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Monoclonal Gammopathy of Undetermined Significance	Monoclonal Gammapathies	BEFREE	27111220		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	25110432	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	15970649	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth Neoplasms	LHGDN	17786320		★★★★★ ★☆☆☆☆ Found in Text Mining only
MPS III B	Mucopolysaccharidosis	BEFREE	24266751, 31309128		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	27111220		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	33469444, 34489947	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	11937266		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	11937266	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	15645136, 9558368		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	28950284, 9269998		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	12505877		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	38037054	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	28143425		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	28143425	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neonatal hypoglycemia	Hypoglycemia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10077643, 10213220, 10220444, 10221816, 10226796, 10369866, 10404060, 10463576, 10468998, 10597307, 10602511, 10634406, 10731720, 10779549, 10779632 View all (274 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms, Germ Cell and Embryonal	Neoplasm	LHGDN	18524796		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms, Intracranial	Intracranial Neoplasm	BEFREE	1779982, 8242555		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	10731720, 10749116, 11053988, 11431321, 11717330, 12702581, 1323141, 14962525, 15677533, 15761865, 16177880, 16518847, 17325026, 17686827, 18245780 View all (49 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	CTD_human_DG	8252039		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrocalcinosis	Nephrocalcinosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrolithiasis	Nephrolithiasis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	30389571		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural Tube Defect	BEFREE	22234160, 23690138, 25423083		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	10462038, 11807663, 12553057, 12700894, 1375906, 15650232, 1991849, 20842449, 2174908, 21917080, 23479510, 7495303, 7589243, 7614476, 7658270 View all (7 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	1331680, 1799864, 1991849, 2174908, 2547840, 39217334, 7495303, 7717451, 8478984, 8482722	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	26993302, 28575743		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroectodermal Tumors	Neuroectodermal Tumors	BEFREE	9049837		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	10964166		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	30484310		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-obstructive azoospermia	Non-obstructive azoospermia	BEFREE	27535712		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	17600088, 24112161, 24485233, 25402559, 27086926, 28381175, 29562959, 31210310, 31366504, 8675593		★★★★★ ★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	18497053		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	31053723		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	10573016, 11935324, 14501587, 16102992, 16251897, 16344856, 17488802, 19560381, 20057340, 22392079, 22907587, 23388414, 23388448, 25675353, 26056743, 28787727, 30277114, 9169130 View all (3 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	CTD_human_DG	11528401		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	17488802, 22341586, 22392079, 22907587, 25923461, 28787727, 30040480, 30277114, 31517621, 32030914	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obstructive azoospermia	Obstructive azoospermia	BEFREE	27535712		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oligospermia	Oligospermia	BEFREE	19878521, 27535712, 30340650		★★★★★ ★☆☆☆☆ Found in Text Mining only
Opitz GBBB Syndrome, X-Linked	Opitz GBBB Syndrome, X-Linked	BEFREE	12588801		★★★★★ ★☆☆☆☆ Found in Text Mining only
Orofacial Cleft 1	Orofacial cleft	Pubtator	21052871	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	33166667, 33639898	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	23363476	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	30729647		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	35641033, 36937804, 37415192	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	12588801, 19427670, 22042095, 23226335, 23527719, 7685579		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	23527719	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	35610231	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosclerosis	Osteosclerosis	Pubtator	9593772	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	10077643, 21846690, 33272626	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Hyperstimulation Syndrome	Ovarian Hyperstimulation Syndrome	BEFREE	12107240		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	10690526, 15661221, 16603642, 17569086, 21109978, 21422097, 23677070, 23877403, 24727326, 24872956, 24932685, 28829218, 8644850, 9669031, 9856569		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	16603642, 17569086		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	16603642, 20404007, 21109978, 21422097, 21711548, 23677070, 31114986, 31488892, 31922228, 35391781, 36245227, 39896800, 8557160, 8644850, 9130892	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
PACHYONYCHIA CONGENITA 3	Pachyonychia Congenita	BEFREE	12111694		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	19064563, 25183049, 27895308, 28420208, 30958159, 31261900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	19018773, 19064563, 29157747, 31261900	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	19064563	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatoblastoma	Pancreatoblastoma	BEFREE	29233928		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paraneoplastic Syndromes	Paraneoplastic syndrome	Pubtator	20527023	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	LHGDN	18085551		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	BEFREE	19276553, 28081695		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	CTD_human_DG	19276553		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pediatric Obesity	Childhood obesity	BEFREE	22341586		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peptic Esophagitis	Peptic Esophagitis	BEFREE	20403354		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	34721734	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	Pubtator	20534969, 2547840, 26400872, 3029761	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	2405002, 26400872, 3029761, 7964281, 8370710		★★★★★ ★☆☆☆☆ Found in Text Mining only
Phyllodes Tumor	Phyllodes Tumor	BEFREE	26676988		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pleuropulmonary blastoma	Pleuropulmonary blastoma	BEFREE	26056800		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	15181035, 22738153, 26283014, 29374985, 30343311, 30672430, 31772271, 8654631		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	15181035, 21824047, 22646060, 31772271, 34107718	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	20452586, 20528206	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	8654631	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	BEFREE	10640993, 15380337		★★★★★ ★☆☆☆☆ Found in Text Mining only
Port-Wine Stain	Phakomatosis pigmentovascularis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Precocious pubarche	Precocious Pubarche	BEFREE	22646060		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	12804639		★★★★★ ★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	CTD_human_DG	15750215		★★★★★ ★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	26993302		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	BEFREE	15380337		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	10218964, 11597555, 12550081, 12610512, 14712493, 16018936, 16397247, 18563715, 18701505, 19016246, 19513555, 22293856, 23319492, 23890537, 24615121 View all (12 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	29129118	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	7521342	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic Hyperplasia	BEFREE	9215294		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	BEFREE	14666684, 8855837		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	10931743, 21432864, 29017567		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	11020056, 18563715, 21432864, 22219177, 22392079, 23135352, 23890537, 24513574, 24824313, 29017567, 8646598	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	18701505		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	21983635, 29239100	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pseudohypoparathyroidism	Pseudohypoparathyroidism	Pubtator	22679513	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	11097836		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	Pubtator	37935955	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psychotic Disorders	Psychosis	BEFREE	31053723		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	36937804	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	LHGDN	18467708		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	18467708, 31765403	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pyogenic granuloma	Pyogenic granuloma	BEFREE	15706404		★★★★★ ★☆☆☆☆ Found in Text Mining only
Reactive hypoglycemia	Reactive hypoglycemia	CTD_human_DG	3185662		★★★★★ ★☆☆☆☆ Found in Text Mining only
Relative macrocephaly	Macrocephaly	BEFREE	31544945		★★★★★ ★☆☆☆☆ Found in Text Mining only
Relative macrocephaly	Macrocephaly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	9205056, 9455791		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	29889555		★★★★★ ★☆☆☆☆ Found in Text Mining only
Resistance to Insulin-Like Growth Factor I	IGF-I RESISTANCE	BEFREE	23527719, 24668028, 26369544, 28193878, 28343662, 28534511, 28873464, 29112114, 29716918		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	18997086		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal detachment	Pubtator	31317640	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis pigmentosa	Pubtator	29017567	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	28343662		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rett Syndrome	Rett Syndrome	BEFREE	12107440		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdoid Tumor	Rhabdoid Tumor	BEFREE	28521298		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdoid Tumor	Rhabdoid tumor	Pubtator	28521298	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	10935489, 24173021, 26572961, 7499276, 7577472	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	12234381, 12942549, 1434543, 18788888, 22289848, 23079386, 2315312, 24173021, 24704827, 24846856, 26572961, 30732578, 7499276, 7686519, 7794794 View all (8 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rhabdomyosarcoma	Rhabdomyosarcoma	CTD_human_DG	7981680		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	8040287	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rhabdomyosarcoma Embryonal	Rhabdomyosarcoma	Pubtator	26056800, 26572961, 8040287	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	15163116		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	19556211, 7738951		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rickets	Rickets	BEFREE	30845974		★★★★★ ★☆☆☆☆ Found in Text Mining only
Russell-Silver syndrome	Russell-Silver Syndrome	BEFREE	16615080, 16940449, 18159214, 18230663, 18365005, 18473334, 18607558, 19066168, 19632365, 20007505, 20062522, 20082469, 20385510, 20503324, 21278389 View all (17 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Russell-Silver syndrome	Russell-Silver Syndrome	CTD_human_DG	19066168		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Russell-Silver syndrome	Russell-Silver Syndrome	GENOMICS_ENGLAND_DG	26154720		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Russell-Silver syndrome	Russell-Silver Syndrome	CLINVAR_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Sarcoma	BEFREE	10725783, 18855347, 19586133, 22674894, 23527719, 2584352, 8545106, 9177406		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	15575249, 23527719, 24298054, 26666605	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Clear Cell	Sarcoma	Pubtator	8424465	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	19407853, 22022506, 22798295, 32115849	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Synovial	Synovial sarcoma	Pubtator	12414507, 19407853, 19936258	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	19394958, 24956249		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	19394958, 24956249		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Scleroderma Systemic	Systemic sclerosis	Pubtator	18467708, 31765403	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Scoliosis, unspecified	Scoliosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	Pubtator	15967097	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	BEFREE	16721595		★★★★★ ★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Senile Plaques	Senile Plaques	BEFREE	17561313, 31266549		★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe myopia	Myopia	BEFREE	25266237		★★★★★ ★☆☆☆☆ Found in Text Mining only
Silver-Russell syndrome due to 11p15 microduplication	Silver-Russell Syndrome	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Silver-Russell syndrome due to a point mutation	Silver-Russell Syndrome	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Silver-Russell syndrome due to an imprinting defect of 11p15	Silver-Russell Syndrome	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SIMPSON-GOLABI-BEHMEL SYNDROME, TYPE 1	Simpson-Golabi-Behmel Syndrome	BEFREE	9630066		★★★★★ ★☆☆☆☆ Found in Text Mining only
Soft Tissue Neoplasms	Soft Tissue Neoplasms	BEFREE	1434543		★★★★★ ★☆☆☆☆ Found in Text Mining only
Solitary fibrous tumor	Solitary fibrous tumor	BEFREE	11306891, 20527023, 20709701, 27585487, 29897468		★★★★★ ★☆☆☆☆ Found in Text Mining only
Somatotropin deficiency	Somatotropin Deficiency	BEFREE	27651465		★★★★★ ★☆☆☆☆ Found in Text Mining only
Somatotropin deficiency	Somatotropin Deficiency	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Sotos Syndrome	Sotos syndrome	Pubtator	31914674	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophy	Spinal Muscular Atrophy	BEFREE	27180807		★★★★★ ★☆☆☆☆ Found in Text Mining only
Split hand foot deformity 1	Split hand foot deformity	BEFREE	28489339		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sporadic Breast Carcinoma	Breast Carcinoma	BEFREE	9196048		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	10597307, 15514114, 20652886, 21668571, 22643116, 27232357		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	18604514		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	17183068, 23943562, 24318096, 24706416, 29115555, 29207103, 31364117		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	16111804, 18836279	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	20443017, 24802266		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	16344856, 30277114		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steroid Sulfatase Deficiency Disease	Steroid Sulfatase Deficiency Disease	BEFREE	22770876		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	11677116, 16264263, 16847924, 1693565, 21268128, 22447362, 24451943, 28871451, 31361067		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	18158559, 19737423, 23934455, 27583849, 34108525, 34321174, 37718779	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Strawberry nevus of skin	Strawberry Nevus Of Skin	BEFREE	15706404, 18287964, 26496499, 30867686		★★★★★ ★☆☆☆☆ Found in Text Mining only
Syndactyly	Syndactyly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	12414507, 16247461, 18855347, 19936258		★★★★★ ★☆☆☆☆ Found in Text Mining only
TARSAL-CARPAL COALITION SYNDROME	Tarsal-Carpal Coalition Syndrome	BEFREE	21162716		★★★★★ ★☆☆☆☆ Found in Text Mining only
Temple syndrome	Temple syndrome	Pubtator	34039421	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Teratozoospermia	Teratozoospermia	BEFREE	19584898		★★★★★ ★☆☆☆☆ Found in Text Mining only
Teratozoospermia	Teratozoospermia	Pubtator	19584898	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Testicular Feminization	Testicular Feminization	BEFREE	11600534, 12876417		★★★★★ ★☆☆☆☆ Found in Text Mining only
Testicular Neoplasms	Testicular neoplasm	Pubtator	26496499	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Testicular Neoplasms	Testicular Neoplasms	BEFREE	9112575		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	BEFREE	15380337		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	34537745, 38092752	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	21123448, 30513575		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	34184083	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	21123448, 30513575, 9888478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	30272326	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Trichohepatoenteric Syndrome	Trichohepatoenteric Syndrome	BEFREE	11751681		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	23539627, 25874233, 29099049, 29217458, 29771420, 30338035		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	25874233, 29099049	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tumors of Adrenal Cortex	Tumors Of Adrenal Cortex	BEFREE	10425444, 10634406, 18611974, 25089899		★★★★★ ★☆☆☆☆ Found in Text Mining only
Turcot syndrome	Turcot syndrome	Pubtator	30578081	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Turner Syndrome	Turner Syndrome	BEFREE	9100570		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	15935984		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ulcerative Colitis	Ulcerative colitis	LHGDN	15935984		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uranostaphyloschisis	Uranostaphyloschisis	BEFREE	27307343, 29081343		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	10944603, 18980977, 32427884	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Carcinosarcoma	Endometrial Cancer	BEFREE	29455465		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	23775149	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	36508036	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	11997082, 23464477, 23775149, 30949792, 31488892, 8618825	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	36508036	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	1358435, 1979007, 20651370, 2208134, 23355533, 23485847, 25015674, 28324020, 29891843, 7684390, 7745016, 7902208, 8821886, 9184179		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vasospasm Intracranial	Intracranial vasospasm	Pubtator	35144409	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular Septal Defects	Ventricular septal defect	BEFREE	28553678		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vesico-Ureteral Reflux	Vesicoureteral Reflux	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Werner Syndrome	Werner syndrome	Pubtator	1719537	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Werner Syndrome	Werner Syndrome	BEFREE	7693501		★★★★★ ★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	10220444, 10506193, 11056398, 11212886, 15677533, 15798773, 16909133, 17686827, 18245780, 18365005, 18644976, 19047088, 22409817, 23825673, 2537832 View all (15 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Xeroderma pigmentosum, group A	Xeroderma Pigmentosum	BEFREE	20651370		★★★★★ ★☆☆☆☆ Found in Text Mining only

IGF2 (insulin like growth factor 2)