Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	348093
Gene name	RNA binding protein, mRNA processing factor 2
Gene symbol	RBPMS2
Synonyms (NCBI Gene)	-
Chromosome	15
Chromosome location	15q22.31
Summary	The protein encoded by this gene is a member of the RNA recognition motif (RRM)-containing protein family and is involved in the development and dedifferentiation of digestive smooth muscle cells. The encoded protein functions as a homodimer and indirectl

Show/Hide all (50)

miRTarBase ID	miRNA	Experiments	Reference
MIRT046244	hsa-miR-23b-3p	CLASH	23622248
MIRT1297424	hsa-miR-105	CLIP-seq
MIRT1297425	hsa-miR-1229	CLIP-seq
MIRT1297426	hsa-miR-128	CLIP-seq
MIRT1297427	hsa-miR-1292	CLIP-seq
MIRT1297428	hsa-miR-205	CLIP-seq
MIRT1297429	hsa-miR-23a	CLIP-seq
MIRT1297430	hsa-miR-23b	CLIP-seq
MIRT1297431	hsa-miR-23c	CLIP-seq
MIRT1297432	hsa-miR-33a	CLIP-seq
MIRT1297433	hsa-miR-33b	CLIP-seq
MIRT1297434	hsa-miR-342-3p	CLIP-seq
MIRT1297435	hsa-miR-34a	CLIP-seq
MIRT1297436	hsa-miR-34c-5p	CLIP-seq
MIRT1297437	hsa-miR-3616-3p	CLIP-seq
MIRT1297438	hsa-miR-3908	CLIP-seq
MIRT1297439	hsa-miR-3944-5p	CLIP-seq
MIRT1297440	hsa-miR-4436b-3p	CLIP-seq
MIRT1297441	hsa-miR-4471	CLIP-seq
MIRT1297442	hsa-miR-449a	CLIP-seq
MIRT1297443	hsa-miR-449b	CLIP-seq
MIRT1297444	hsa-miR-450b-5p	CLIP-seq
MIRT1297445	hsa-miR-4532	CLIP-seq
MIRT1297446	hsa-miR-4632	CLIP-seq
MIRT1297447	hsa-miR-4660	CLIP-seq
MIRT1297448	hsa-miR-486-3p	CLIP-seq
MIRT1297449	hsa-miR-507	CLIP-seq
MIRT1297450	hsa-miR-513a-5p	CLIP-seq
MIRT1297451	hsa-miR-516b	CLIP-seq
MIRT1297452	hsa-miR-545	CLIP-seq
MIRT1297453	hsa-miR-549	CLIP-seq
MIRT1297454	hsa-miR-557	CLIP-seq
MIRT1297455	hsa-miR-579	CLIP-seq
MIRT1297456	hsa-miR-646	CLIP-seq
MIRT2088398	hsa-miR-1908	CLIP-seq
MIRT2088399	hsa-miR-663	CLIP-seq
MIRT2313312	hsa-miR-1321	CLIP-seq
MIRT2313313	hsa-miR-203	CLIP-seq
MIRT2313314	hsa-miR-3660	CLIP-seq
MIRT2313315	hsa-miR-4419a	CLIP-seq
MIRT2313316	hsa-miR-4422	CLIP-seq
MIRT2313317	hsa-miR-4435	CLIP-seq
MIRT2313318	hsa-miR-4510	CLIP-seq
MIRT2313319	hsa-miR-4526	CLIP-seq
MIRT2313320	hsa-miR-4645-3p	CLIP-seq
MIRT2313321	hsa-miR-4728-5p	CLIP-seq
MIRT2313322	hsa-miR-4739	CLIP-seq
MIRT2313323	hsa-miR-4756-5p	CLIP-seq
MIRT2313324	hsa-miR-4766-5p	CLIP-seq
MIRT2313325	hsa-miR-4779	CLIP-seq

Show/Hide all (24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000381	Process	Regulation of alternative mRNA splicing, via spliceosome	IEA
GO:0000381	Process	Regulation of alternative mRNA splicing, via spliceosome	ISS
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003723	Function	RNA binding	IEA
GO:0003729	Function	MRNA binding	IBA
GO:0003729	Function	MRNA binding	IDA	25064856
GO:0005515	Function	Protein binding	IPI	25064856, 28514442, 32296183, 33961781
GO:0005634	Component	Nucleus	IDA	24860013
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	25064856
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA	24860013
GO:0010494	Component	Cytoplasmic stress granule	IDA	24860013
GO:0010494	Component	Cytoplasmic stress granule	IEA
GO:0030514	Process	Negative regulation of BMP signaling pathway	ISS
GO:0042802	Function	Identical protein binding	IPI	32296183
GO:0042803	Function	Protein homodimerization activity	IEA
GO:0042803	Function	Protein homodimerization activity	IPI	25064856
GO:0048557	Process	Embryonic digestive tract morphogenesis	ISS
GO:0048661	Process	Positive regulation of smooth muscle cell proliferation	ISS
GO:0051151	Process	Negative regulation of smooth muscle cell differentiation	IBA
GO:0051151	Process	Negative regulation of smooth muscle cell differentiation	IMP	25064856
GO:0051151	Process	Negative regulation of smooth muscle cell differentiation	ISS

MIM	HGNC	e!Ensembl
619034	19098	ENSG00000166831

Q6ZRY4

Protein name

RNA-binding protein with multiple splicing 2 (RNA binding protein, mRNA processing factor 2)

Protein function

RNA-binding protein involved in the regulation of smooth muscle cell differentiation and proliferation in the gastrointestinal system (PubMed:25064856). Binds NOG mRNA, the major inhibitor of the bone morphogenetic protein (BMP) pathway. Mediate

PDB

2M9K

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00076	RRM_1	33 → 97	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain

Sequence

MSNLKPDGEHGGSTGTGSGAGSGGALEEEVRTLFVSGLPVDIKPRELYLLFRPFKGYEGS
LIKLTARQPVGFVIFDSRAGAEAAKNALNGIRFDPENPQTLRLEFAKANTKMAKSKLMAT
PNPSNVHPALGAHFIARDPYDLMGAALIPASPEAWAPYPLYTTELTPAISHAAFTYPTAT
AAAAALHAQVRWYPSSDTTQQGWKYRQFC

Sequence length

209

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (11)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alzheimer Disease	Alzheimer disease	Pubtator	33804025	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	22683258		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	35137653	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	29301256	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Primary Pulmonary Hypertension	Pulmonary hypertension	Pubtator	34981661	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	23295309		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung Disease	BEFREE	22683258		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	23295309		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	25371445	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	31959204, 32878427, 34001012	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	35137653	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only

RBPMS2 (RNA binding protein, mRNA processing factor 2)