IGF1 (insulin like growth factor 1)

Gene

• Entrez ID: 3479
• Gene name: Insulin like growth factor 1
• Gene symbol: IGF1
• Synonyms (NCBI Gene): IGF, IGF-I, IGFI, MGF
• Chromosome: 12
• Chromosome location: 12q23.2
• Summary: The protein encoded by this gene is similar to insulin in function and structure and is a member of a family of proteins involved in mediating growth and development. The encoded protein is processed from a precursor, bound by a specific receptor, and sec

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs147960415	C>T	Conflicting-interpretations-of-pathogenicity	Synonymous variant, coding sequence variant
rs1566009282	C>A	Likely-pathogenic	Splice donor variant
rs1592837549	->C	Likely-pathogenic	Coding sequence variant, frameshift variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT006431	hsa-miR-27a-3p	Luciferase reporter assay	21643012
MIRT006431	hsa-miR-27a-3p	Luciferase reporter assay	21643012
MIRT006431	hsa-miR-27a-3p	Luciferase reporter assay	21643012
MIRT006431	hsa-miR-27a-3p	Luciferase reporter assay	21643012
MIRT006431	hsa-miR-27a-3p	ELISA, GFP reporter assay, Immunoblot, Immunoprecipitaion, Luciferase reporter assay, qRT-PCR, Western blot	21643012
MIRT006431	hsa-miR-27a-3p	ELISA, GFP reporter assay, Immunoblot, Immunoprecipitaion, Luciferase reporter assay, qRT-PCR, Western blot	21643012
MIRT006431	hsa-miR-27a-3p	Luciferase reporter assay	21643012
MIRT006431	hsa-miR-27a-3p	Luciferase reporter assay	21643012
MIRT006431	hsa-miR-27a-3p	ELISA, GFP reporter assay, Immunoblot, Immunoprecipitaion, Luciferase reporter assay, qRT-PCR, Western blot	21643012
MIRT006431	hsa-miR-27a-3p	ELISA, GFP reporter assay, Immunoblot, Immunoprecipitaion, Luciferase reporter assay, qRT-PCR, Western blot	21643012
MIRT001844	hsa-miR-1-3p	Other	15951802
MIRT053205	hsa-miR-483-3p	Flow, Immunoblot, Luciferase reporter assay, qRT-PCR, Western blot	23403580
MIRT054579	hsa-let-7e-5p	Luciferase reporter assay, qRT-PCR, Western blot	24582811
MIRT054579	hsa-let-7e-5p	Luciferase reporter assay, qRT-PCR, Western blot	24582811
MIRT054579	hsa-let-7e-5p	Luciferase reporter assay, qRT-PCR, Western blot	24582811
MIRT054579	hsa-let-7e-5p	Luciferase reporter assay, qRT-PCR, Western blot	24582811
MIRT054581	hsa-miR-190b	Immunofluorescence, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	24586785
MIRT054581	hsa-miR-190b	Immunofluorescence, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	24586785
MIRT054581	hsa-miR-190b	Immunofluorescence, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	24586785
MIRT054581	hsa-miR-190b	Immunofluorescence, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	24586785
MIRT054905	hsa-miR-299-3p	qRT-PCR	23362143
MIRT437345	hsa-let-7i-5p	Luciferase reporter assay, Western blot	25305490
MIRT437345	hsa-let-7i-5p	Luciferase reporter assay, Western blot	25305490
MIRT438679	hsa-miR-29a-3p	Luciferase reporter assay, qRT-PCR, Western blot	23960076
MIRT438368	hsa-miR-190a-5p	Luciferase reporter assay, qRT-PCR	24962367
MIRT438017	hsa-miR-199a-3p	Luciferase reporter assay, Wetsern blot, qRT-PCR	24378853
MIRT438679	hsa-miR-29a-3p	Luciferase reporter assay, qRT-PCR, Western blot	23960076
MIRT438368	hsa-miR-190a-5p	Luciferase reporter assay, qRT-PCR	24962367
MIRT438017	hsa-miR-199a-3p	Luciferase reporter assay, Wetsern blot, qRT-PCR	24378853
MIRT632846	hsa-miR-214-5p	HITS-CLIP	23824327
MIRT632845	hsa-miR-6811-3p	HITS-CLIP	23824327
MIRT632844	hsa-miR-6847-3p	HITS-CLIP	23824327
MIRT632842	hsa-miR-4284	HITS-CLIP	23824327
MIRT632841	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT632840	hsa-miR-7106-5p	HITS-CLIP	23824327
MIRT632839	hsa-miR-149-3p	HITS-CLIP	23824327
MIRT632838	hsa-miR-4728-5p	HITS-CLIP	23824327
MIRT632837	hsa-miR-6785-5p	HITS-CLIP	23824327
MIRT632836	hsa-miR-6883-5p	HITS-CLIP	23824327
MIRT632835	hsa-miR-6799-5p	HITS-CLIP	23824327
MIRT632834	hsa-miR-7977	HITS-CLIP	23824327
MIRT632832	hsa-miR-6514-3p	HITS-CLIP	23824327
MIRT632831	hsa-miR-30c-1-3p	HITS-CLIP	23824327
MIRT632830	hsa-miR-30c-2-3p	HITS-CLIP	23824327
MIRT632829	hsa-miR-6788-5p	HITS-CLIP	23824327
MIRT632828	hsa-miR-1273h-5p	HITS-CLIP	23824327
MIRT632827	hsa-miR-30b-3p	HITS-CLIP	23824327
MIRT632826	hsa-miR-3689a-3p	HITS-CLIP	23824327
MIRT632825	hsa-miR-3689b-3p	HITS-CLIP	23824327
MIRT632824	hsa-miR-3689c	HITS-CLIP	23824327
MIRT632823	hsa-miR-6779-5p	HITS-CLIP	23824327
MIRT632822	hsa-miR-6780a-5p	HITS-CLIP	23824327
MIRT632821	hsa-miR-450a-1-3p	HITS-CLIP	23824327
MIRT632820	hsa-miR-3122	HITS-CLIP	23824327
MIRT632819	hsa-miR-3913-5p	HITS-CLIP	23824327
MIRT632818	hsa-miR-887-5p	HITS-CLIP	23824327
MIRT632817	hsa-miR-6513-5p	HITS-CLIP	23824327
MIRT657220	hsa-miR-567	HITS-CLIP	23824327
MIRT657219	hsa-miR-223-5p	HITS-CLIP	23824327
MIRT657218	hsa-miR-4711-3p	HITS-CLIP	23824327
MIRT657217	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT657216	hsa-miR-297	HITS-CLIP	23824327
MIRT657215	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT632854	hsa-miR-3929	HITS-CLIP	23824327
MIRT632853	hsa-miR-4419b	HITS-CLIP	23824327
MIRT632852	hsa-miR-4478	HITS-CLIP	23824327
MIRT632851	hsa-miR-4649-3p	HITS-CLIP	23824327
MIRT632850	hsa-miR-3197	HITS-CLIP	23824327
MIRT632849	hsa-miR-6087	HITS-CLIP	23824327
MIRT632848	hsa-miR-485-5p	HITS-CLIP	23824327
MIRT632847	hsa-miR-6884-5p	HITS-CLIP	23824327
MIRT632846	hsa-miR-214-5p	HITS-CLIP	23824327
MIRT632845	hsa-miR-6811-3p	HITS-CLIP	23824327
MIRT632844	hsa-miR-6847-3p	HITS-CLIP	23824327
MIRT632843	hsa-miR-7160-5p	HITS-CLIP	23824327
MIRT632842	hsa-miR-4284	HITS-CLIP	23824327
MIRT632841	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT632840	hsa-miR-7106-5p	HITS-CLIP	23824327
MIRT632839	hsa-miR-149-3p	HITS-CLIP	23824327
MIRT632838	hsa-miR-4728-5p	HITS-CLIP	23824327
MIRT632837	hsa-miR-6785-5p	HITS-CLIP	23824327
MIRT632836	hsa-miR-6883-5p	HITS-CLIP	23824327
MIRT632835	hsa-miR-6799-5p	HITS-CLIP	23824327
MIRT632834	hsa-miR-7977	HITS-CLIP	23824327
MIRT632833	hsa-miR-6765-5p	HITS-CLIP	23824327
MIRT632832	hsa-miR-6514-3p	HITS-CLIP	23824327
MIRT632831	hsa-miR-30c-1-3p	HITS-CLIP	23824327
MIRT632830	hsa-miR-30c-2-3p	HITS-CLIP	23824327
MIRT632829	hsa-miR-6788-5p	HITS-CLIP	23824327
MIRT632828	hsa-miR-1273h-5p	HITS-CLIP	23824327
MIRT632827	hsa-miR-30b-3p	HITS-CLIP	23824327
MIRT632826	hsa-miR-3689a-3p	HITS-CLIP	23824327
MIRT632825	hsa-miR-3689b-3p	HITS-CLIP	23824327
MIRT632824	hsa-miR-3689c	HITS-CLIP	23824327
MIRT632823	hsa-miR-6779-5p	HITS-CLIP	23824327
MIRT632822	hsa-miR-6780a-5p	HITS-CLIP	23824327
MIRT632821	hsa-miR-450a-1-3p	HITS-CLIP	23824327
MIRT632820	hsa-miR-3122	HITS-CLIP	23824327
MIRT632819	hsa-miR-3913-5p	HITS-CLIP	23824327
MIRT632818	hsa-miR-887-5p	HITS-CLIP	23824327
MIRT632817	hsa-miR-6513-5p	HITS-CLIP	23824327
MIRT523036	hsa-miR-665	HITS-CLIP	23824327
MIRT523043	hsa-miR-4662a-3p	PAR-CLIP	21572407
MIRT523042	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT523041	hsa-miR-211-3p	PAR-CLIP	21572407
MIRT523040	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT523039	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT523043	hsa-miR-4662a-3p	PAR-CLIP	21572407
MIRT523042	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT523041	hsa-miR-211-3p	PAR-CLIP	21572407
MIRT523040	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT523039	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT536731	hsa-miR-10a-3p	PAR-CLIP	22012620
MIRT536730	hsa-miR-3065-5p	PAR-CLIP	22012620
MIRT536729	hsa-miR-130b-5p	PAR-CLIP	22012620
MIRT536728	hsa-miR-7159-5p	PAR-CLIP	22012620
MIRT536727	hsa-miR-505-3p	PAR-CLIP	22012620
MIRT536726	hsa-miR-421	PAR-CLIP	22012620
MIRT536725	hsa-miR-4753-3p	PAR-CLIP	22012620
MIRT536724	hsa-miR-1305	PAR-CLIP	22012620
MIRT523043	hsa-miR-4662a-3p	PAR-CLIP	23446348
MIRT523042	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT523041	hsa-miR-211-3p	PAR-CLIP	23446348
MIRT523040	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT523039	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT523038	hsa-miR-6771-3p	PAR-CLIP	23446348
MIRT523037	hsa-miR-4459	PAR-CLIP	23446348
MIRT523036	hsa-miR-665	PAR-CLIP	23446348
MIRT523035	hsa-miR-6840-3p	PAR-CLIP	23446348
MIRT523034	hsa-miR-302a-5p	PAR-CLIP	23446348
MIRT523033	hsa-miR-6134	PAR-CLIP	23446348
MIRT523032	hsa-miR-377-5p	PAR-CLIP	23446348
MIRT523031	hsa-miR-6086	PAR-CLIP	23446348
MIRT523030	hsa-miR-6499-3p	PAR-CLIP	23446348
MIRT523029	hsa-miR-3689d	PAR-CLIP	23446348
MIRT523028	hsa-miR-6851-5p	PAR-CLIP	23446348
MIRT523027	hsa-miR-6880-5p	PAR-CLIP	23446348
MIRT523026	hsa-miR-7847-3p	PAR-CLIP	23446348
MIRT523025	hsa-miR-455-3p	PAR-CLIP	23446348
MIRT523024	hsa-miR-6516-5p	PAR-CLIP	23446348
MIRT449944	hsa-miR-539-5p	PAR-CLIP	22100165
MIRT449943	hsa-miR-7641	PAR-CLIP	22100165
MIRT449942	hsa-miR-4273	PAR-CLIP	22100165
MIRT449941	hsa-miR-7156-5p	PAR-CLIP	22100165
MIRT449940	hsa-miR-576-5p	PAR-CLIP	22100165
MIRT449939	hsa-miR-6739-3p	PAR-CLIP	22100165
MIRT731340	hsa-miR-133a-3p	Luciferase reporter assay	26845446
MIRT731340	hsa-miR-133a-3p	Luciferase reporter assay	26845446
MIRT731359	hsa-miR-18b-5p	Luciferase reporter assay	26851511
MIRT731359	hsa-miR-18b-5p	Luciferase reporter assay	26851511
MIRT731420	hsa-miR-28-5p	Luciferase reporter assay, qRT-PCR, Western blot	26160280
MIRT731420	hsa-miR-28-5p	Luciferase reporter assay, qRT-PCR, Western blot	26160280
MIRT001844	hsa-miR-1-3p	Luciferase reporter assay, qRT-PCR, Western blot	26166810
MIRT001844	hsa-miR-1-3p	Luciferase reporter assay, qRT-PCR, Western blot	26166810
MIRT731735	hsa-miR-603	Luciferase reporter assay, qRT-PCR, Western blot	26068646
MIRT731735	hsa-miR-603	Luciferase reporter assay, qRT-PCR, Western blot	26068646
MIRT732179	hsa-miR-130b-3p	ELISA, Luciferase reporter assay, Microarray, pSILAC, Western blot	26953888
MIRT732179	hsa-miR-130b-3p	ELISA, Luciferase reporter assay, Microarray, pSILAC, Western blot	26953888
MIRT732179	hsa-miR-130b-3p	ELISA, Luciferase reporter assay, Microarray, pSILAC, Western blot	26953888
MIRT732179	hsa-miR-130b-3p	ELISA, Luciferase reporter assay, Microarray, pSILAC, Western blot	26953888
MIRT073671	hsa-miR-98-5p	Luciferase reporter assay, qRT-PCR, Western blot	26722410
MIRT732227	hsa-miR-98-5p	Luciferase reporter assay, qRT-PCR, Western blot	26722410
MIRT731359	hsa-miR-18b-5p	Luciferase reporter assay	25756952
MIRT731359	hsa-miR-18b-5p	Luciferase reporter assay	25756952
MIRT657219	hsa-miR-223-5p	HITS-CLIP	27418678
MIRT657216	hsa-miR-297	HITS-CLIP	27418678
MIRT575626	hsa-miR-4711-3p	HITS-CLIP	27418678
MIRT657220	hsa-miR-567	HITS-CLIP	27418678
MIRT575624	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT575625	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT632841	hsa-miR-24-3p	qRT-PCR	33909697
MIRT732610	hsa-miR-150-3p	qRT-PCR	33909697
MIRT438017	hsa-miR-199a-3p	qRT-PCR	33909697
MIRT732614	hsa-miR-214-3p	qRT-PCR	33909697
MIRT735120	hsa-miR-19b-3p	qRT-PCR	31776299
MIRT735291	hsa-miR-28-3p	qRT-PCR	32425976
MIRT731735	hsa-miR-603	Luciferase reporter assay, Western blotting, Immunohistochemistry (IHC), Immunofluorescence, qRT-PCR, ELISA	32361246
MIRT438017	hsa-miR-199a-3p	Western blotting, qRT-PCR	31789347
MIRT736639	hsa-miR-145-5p	Luciferase reporter assay, Western blotting, qRT-PCR, Flow cytometry	32494158
MIRT736910	hsa-miR-130a-3p	Luciferase reporter assay, Western blotting, qRT-PCR	33732359
MIRT632846	hsa-miR-214-5p	HITS-CLIP	23824327
MIRT632845	hsa-miR-6811-3p	HITS-CLIP	23824327
MIRT632844	hsa-miR-6847-3p	HITS-CLIP	23824327
MIRT632842	hsa-miR-4284	HITS-CLIP	23824327
MIRT632841	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT632840	hsa-miR-7106-5p	HITS-CLIP	23824327
MIRT632839	hsa-miR-149-3p	HITS-CLIP	23824327
MIRT632838	hsa-miR-4728-5p	HITS-CLIP	23824327
MIRT632837	hsa-miR-6785-5p	HITS-CLIP	23824327
MIRT632836	hsa-miR-6883-5p	HITS-CLIP	23824327
MIRT632835	hsa-miR-6799-5p	HITS-CLIP	23824327
MIRT632834	hsa-miR-7977	HITS-CLIP	23824327
MIRT632832	hsa-miR-6514-3p	HITS-CLIP	23824327
MIRT632831	hsa-miR-30c-1-3p	HITS-CLIP	23824327
MIRT632830	hsa-miR-30c-2-3p	HITS-CLIP	23824327
MIRT632829	hsa-miR-6788-5p	HITS-CLIP	23824327
MIRT632828	hsa-miR-1273h-5p	HITS-CLIP	23824327
MIRT632827	hsa-miR-30b-3p	HITS-CLIP	23824327
MIRT632826	hsa-miR-3689a-3p	HITS-CLIP	23824327
MIRT632825	hsa-miR-3689b-3p	HITS-CLIP	23824327
MIRT632824	hsa-miR-3689c	HITS-CLIP	23824327
MIRT632823	hsa-miR-6779-5p	HITS-CLIP	23824327
MIRT632822	hsa-miR-6780a-5p	HITS-CLIP	23824327
MIRT632821	hsa-miR-450a-1-3p	HITS-CLIP	23824327
MIRT632820	hsa-miR-3122	HITS-CLIP	23824327
MIRT632819	hsa-miR-3913-5p	HITS-CLIP	23824327
MIRT632818	hsa-miR-887-5p	HITS-CLIP	23824327
MIRT632817	hsa-miR-6513-5p	HITS-CLIP	23824327
MIRT657220	hsa-miR-567	HITS-CLIP	23824327
MIRT657219	hsa-miR-223-5p	HITS-CLIP	23824327
MIRT575626	hsa-miR-4711-3p	HITS-CLIP	23824327
MIRT575625	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT657216	hsa-miR-297	HITS-CLIP	23824327
MIRT575624	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT632854	hsa-miR-3929	HITS-CLIP	23824327
MIRT632853	hsa-miR-4419b	HITS-CLIP	23824327
MIRT632852	hsa-miR-4478	HITS-CLIP	23824327
MIRT632851	hsa-miR-4649-3p	HITS-CLIP	23824327
MIRT632850	hsa-miR-3197	HITS-CLIP	23824327
MIRT632849	hsa-miR-6087	HITS-CLIP	23824327
MIRT632848	hsa-miR-485-5p	HITS-CLIP	23824327
MIRT632847	hsa-miR-6884-5p	HITS-CLIP	23824327
MIRT632846	hsa-miR-214-5p	HITS-CLIP	23824327
MIRT632845	hsa-miR-6811-3p	HITS-CLIP	23824327
MIRT632844	hsa-miR-6847-3p	HITS-CLIP	23824327
MIRT632843	hsa-miR-7160-5p	HITS-CLIP	23824327
MIRT632842	hsa-miR-4284	HITS-CLIP	23824327
MIRT632841	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT632840	hsa-miR-7106-5p	HITS-CLIP	23824327
MIRT632839	hsa-miR-149-3p	HITS-CLIP	23824327
MIRT632838	hsa-miR-4728-5p	HITS-CLIP	23824327
MIRT632837	hsa-miR-6785-5p	HITS-CLIP	23824327
MIRT632836	hsa-miR-6883-5p	HITS-CLIP	23824327
MIRT632835	hsa-miR-6799-5p	HITS-CLIP	23824327
MIRT632834	hsa-miR-7977	HITS-CLIP	23824327
MIRT632833	hsa-miR-6765-5p	HITS-CLIP	23824327
MIRT632832	hsa-miR-6514-3p	HITS-CLIP	23824327
MIRT632831	hsa-miR-30c-1-3p	HITS-CLIP	23824327
MIRT632830	hsa-miR-30c-2-3p	HITS-CLIP	23824327
MIRT632829	hsa-miR-6788-5p	HITS-CLIP	23824327
MIRT632828	hsa-miR-1273h-5p	HITS-CLIP	23824327
MIRT632827	hsa-miR-30b-3p	HITS-CLIP	23824327
MIRT632826	hsa-miR-3689a-3p	HITS-CLIP	23824327
MIRT632825	hsa-miR-3689b-3p	HITS-CLIP	23824327
MIRT632824	hsa-miR-3689c	HITS-CLIP	23824327
MIRT632823	hsa-miR-6779-5p	HITS-CLIP	23824327
MIRT632822	hsa-miR-6780a-5p	HITS-CLIP	23824327
MIRT632821	hsa-miR-450a-1-3p	HITS-CLIP	23824327
MIRT632820	hsa-miR-3122	HITS-CLIP	23824327
MIRT632819	hsa-miR-3913-5p	HITS-CLIP	23824327
MIRT632818	hsa-miR-887-5p	HITS-CLIP	23824327
MIRT632817	hsa-miR-6513-5p	HITS-CLIP	23824327
MIRT523036	hsa-miR-665	HITS-CLIP	23824327
MIRT523043	hsa-miR-4662a-3p	PAR-CLIP	21572407
MIRT523042	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT523041	hsa-miR-211-3p	PAR-CLIP	21572407
MIRT523040	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT523039	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT523043	hsa-miR-4662a-3p	PAR-CLIP	21572407
MIRT523042	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT523041	hsa-miR-211-3p	PAR-CLIP	21572407
MIRT523040	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT523039	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT536731	hsa-miR-10a-3p	PAR-CLIP	22012620
MIRT536730	hsa-miR-3065-5p	PAR-CLIP	22012620
MIRT536729	hsa-miR-130b-5p	PAR-CLIP	22012620
MIRT536728	hsa-miR-7159-5p	PAR-CLIP	22012620
MIRT536727	hsa-miR-505-3p	PAR-CLIP	22012620
MIRT536726	hsa-miR-421	PAR-CLIP	22012620
MIRT536725	hsa-miR-4753-3p	PAR-CLIP	22012620
MIRT536724	hsa-miR-1305	PAR-CLIP	22012620
MIRT523043	hsa-miR-4662a-3p	PAR-CLIP	23446348
MIRT523042	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT523041	hsa-miR-211-3p	PAR-CLIP	23446348
MIRT523040	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT523039	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT523038	hsa-miR-6771-3p	PAR-CLIP	23446348
MIRT523037	hsa-miR-4459	PAR-CLIP	23446348
MIRT523036	hsa-miR-665	PAR-CLIP	23446348
MIRT523035	hsa-miR-6840-3p	PAR-CLIP	23446348
MIRT523034	hsa-miR-302a-5p	PAR-CLIP	23446348
MIRT523033	hsa-miR-6134	PAR-CLIP	23446348
MIRT523032	hsa-miR-377-5p	PAR-CLIP	23446348
MIRT523031	hsa-miR-6086	PAR-CLIP	23446348
MIRT523030	hsa-miR-6499-3p	PAR-CLIP	23446348
MIRT523029	hsa-miR-3689d	PAR-CLIP	23446348
MIRT523028	hsa-miR-6851-5p	PAR-CLIP	23446348
MIRT523027	hsa-miR-6880-5p	PAR-CLIP	23446348
MIRT523026	hsa-miR-7847-3p	PAR-CLIP	23446348
MIRT523025	hsa-miR-455-3p	PAR-CLIP	23446348
MIRT523024	hsa-miR-6516-5p	PAR-CLIP	23446348
MIRT449944	hsa-miR-539-5p	PAR-CLIP	22100165
MIRT449943	hsa-miR-7641	PAR-CLIP	22100165
MIRT449942	hsa-miR-4273	PAR-CLIP	22100165
MIRT449941	hsa-miR-7156-5p	PAR-CLIP	22100165
MIRT449940	hsa-miR-576-5p	PAR-CLIP	22100165
MIRT449939	hsa-miR-6739-3p	PAR-CLIP	22100165
MIRT755830	hsa-miR-646	Luciferase reporter assay, Western blotting, qRT-PCR, in vitro cullelar assays, Flow cytometry	37155307
MIRT001844	hsa-miR-1-3p	Western blotting, qRT-PCR	35421276
MIRT756067	hsa-miR-222-3p	Luciferase reporter assay, qRT-PCR, Immunofluorescence	35565830
MIRT756077	hsa-miR-302a-3p	Luciferase reporter assay, qRT-PCR, RNA pull down assay	36479381
MIRT053205	hsa-miR-483-3p	Luciferase reporter assay, Western blotting, qRT-PCR	34637043
MIRT1061306	hsa-miR-105	CLIP-seq
MIRT1061307	hsa-miR-1245b-3p	CLIP-seq
MIRT1061308	hsa-miR-1324	CLIP-seq
MIRT1061309	hsa-miR-15a	CLIP-seq
MIRT1061310	hsa-miR-15b	CLIP-seq
MIRT1061311	hsa-miR-16	CLIP-seq
MIRT1061312	hsa-miR-1827	CLIP-seq
MIRT1061313	hsa-miR-1909	CLIP-seq
MIRT1061314	hsa-miR-195	CLIP-seq
MIRT1061315	hsa-miR-219-2-3p	CLIP-seq
MIRT1061316	hsa-miR-24	CLIP-seq
MIRT1061317	hsa-miR-298	CLIP-seq
MIRT1061318	hsa-miR-3143	CLIP-seq
MIRT1061319	hsa-miR-3164	CLIP-seq
MIRT1061320	hsa-miR-3607-3p	CLIP-seq
MIRT1061321	hsa-miR-3609	CLIP-seq
MIRT1061322	hsa-miR-361-5p	CLIP-seq
MIRT1061323	hsa-miR-3616-5p	CLIP-seq
MIRT1061324	hsa-miR-3647-5p	CLIP-seq
MIRT1061325	hsa-miR-3664-3p	CLIP-seq
MIRT1061326	hsa-miR-3678-3p	CLIP-seq
MIRT1061327	hsa-miR-3686	CLIP-seq
MIRT1061328	hsa-miR-3915	CLIP-seq
MIRT1061329	hsa-miR-3928	CLIP-seq
MIRT1061330	hsa-miR-3973	CLIP-seq
MIRT1061331	hsa-miR-3974	CLIP-seq
MIRT1061332	hsa-miR-424	CLIP-seq
MIRT1061333	hsa-miR-4276	CLIP-seq
MIRT1061334	hsa-miR-4282	CLIP-seq
MIRT1061335	hsa-miR-4302	CLIP-seq
MIRT1061336	hsa-miR-4307	CLIP-seq
MIRT1061337	hsa-miR-4433	CLIP-seq
MIRT1061338	hsa-miR-4468	CLIP-seq
MIRT1061339	hsa-miR-4496	CLIP-seq
MIRT1061340	hsa-miR-450b-5p	CLIP-seq
MIRT1061341	hsa-miR-4524	CLIP-seq
MIRT1061342	hsa-miR-4537	CLIP-seq
MIRT1061343	hsa-miR-4662a-5p	CLIP-seq
MIRT1061344	hsa-miR-4690-5p	CLIP-seq
MIRT1061345	hsa-miR-4695-5p	CLIP-seq
MIRT1061346	hsa-miR-4698	CLIP-seq
MIRT1061347	hsa-miR-4738-3p	CLIP-seq
MIRT1061348	hsa-miR-4760-3p	CLIP-seq
MIRT1061349	hsa-miR-4768-3p	CLIP-seq
MIRT1061350	hsa-miR-4795-5p	CLIP-seq
MIRT1061351	hsa-miR-488	CLIP-seq
MIRT1061352	hsa-miR-497	CLIP-seq
MIRT1061353	hsa-miR-498	CLIP-seq
MIRT1061354	hsa-miR-503	CLIP-seq
MIRT1061355	hsa-miR-507	CLIP-seq
MIRT1061356	hsa-miR-510	CLIP-seq
MIRT1061357	hsa-miR-512-5p	CLIP-seq
MIRT1061358	hsa-miR-520g	CLIP-seq
MIRT1061359	hsa-miR-520h	CLIP-seq
MIRT1061360	hsa-miR-543	CLIP-seq
MIRT1061361	hsa-miR-548aa	CLIP-seq
MIRT1061362	hsa-miR-548ag	CLIP-seq
MIRT1061363	hsa-miR-548ah	CLIP-seq
MIRT1061364	hsa-miR-548ai	CLIP-seq
MIRT1061365	hsa-miR-548m	CLIP-seq
MIRT1061366	hsa-miR-557	CLIP-seq
MIRT1061367	hsa-miR-562	CLIP-seq
MIRT1061368	hsa-miR-573	CLIP-seq
MIRT1061369	hsa-miR-607	CLIP-seq
MIRT755830	hsa-miR-646	CLIP-seq
MIRT1061370	hsa-miR-659	CLIP-seq
MIRT1061371	hsa-miR-664	CLIP-seq
MIRT1061372	hsa-miR-802	CLIP-seq
MIRT2014329	hsa-miR-18a	CLIP-seq
MIRT2014330	hsa-miR-18b	CLIP-seq
MIRT1061319	hsa-miR-3164	CLIP-seq
MIRT2014331	hsa-miR-3613-3p	CLIP-seq
MIRT2014332	hsa-miR-3945	CLIP-seq
MIRT2014333	hsa-miR-4252	CLIP-seq
MIRT1061333	hsa-miR-4276	CLIP-seq
MIRT1061338	hsa-miR-4468	CLIP-seq
MIRT1061342	hsa-miR-4537	CLIP-seq
MIRT2014334	hsa-miR-4659a-3p	CLIP-seq
MIRT2014335	hsa-miR-4659b-3p	CLIP-seq
MIRT2014336	hsa-miR-4668-3p	CLIP-seq
MIRT2014337	hsa-miR-4735-3p	CLIP-seq
MIRT2014338	hsa-miR-4793-3p	CLIP-seq
MIRT2014339	hsa-miR-4795-3p	CLIP-seq
MIRT2014340	hsa-miR-548c-3p	CLIP-seq
MIRT2246552	hsa-miR-142-5p	CLIP-seq
MIRT2246553	hsa-miR-148a	CLIP-seq
MIRT2246554	hsa-miR-148b	CLIP-seq
MIRT2246555	hsa-miR-152	CLIP-seq
MIRT1061312	hsa-miR-1827	CLIP-seq
MIRT1061316	hsa-miR-24	CLIP-seq
MIRT2246556	hsa-miR-340	CLIP-seq
MIRT2246557	hsa-miR-3685	CLIP-seq
MIRT2246558	hsa-miR-384	CLIP-seq
MIRT2246559	hsa-miR-3926	CLIP-seq
MIRT1061342	hsa-miR-4537	CLIP-seq
MIRT1061345	hsa-miR-4695-5p	CLIP-seq
MIRT2246560	hsa-miR-4722-5p	CLIP-seq
MIRT1061349	hsa-miR-4768-3p	CLIP-seq
MIRT2246561	hsa-miR-499-3p	CLIP-seq
MIRT2246562	hsa-miR-499a-3p	CLIP-seq
MIRT2246563	hsa-miR-513a-3p	CLIP-seq
MIRT2246564	hsa-miR-653	CLIP-seq
MIRT2246565	hsa-miR-940	CLIP-seq
MIRT2389281	hsa-let-7a	CLIP-seq
MIRT2389282	hsa-let-7b	CLIP-seq
MIRT2389283	hsa-let-7c	CLIP-seq
MIRT2389284	hsa-let-7d	CLIP-seq
MIRT2389285	hsa-let-7e	CLIP-seq
MIRT2389286	hsa-let-7f	CLIP-seq
MIRT2389287	hsa-let-7g	CLIP-seq
MIRT2389288	hsa-let-7i	CLIP-seq
MIRT1061306	hsa-miR-105	CLIP-seq
MIRT2389289	hsa-miR-1304	CLIP-seq
MIRT2389290	hsa-miR-196a	CLIP-seq
MIRT2389291	hsa-miR-196b	CLIP-seq
MIRT2389292	hsa-miR-202	CLIP-seq
MIRT2389293	hsa-miR-3927	CLIP-seq
MIRT2389294	hsa-miR-4458	CLIP-seq
MIRT2389295	hsa-miR-4500	CLIP-seq
MIRT2389296	hsa-miR-4643	CLIP-seq
MIRT2389297	hsa-miR-98	CLIP-seq
MIRT2550097	hsa-miR-1179	CLIP-seq
MIRT2550098	hsa-miR-1182	CLIP-seq
MIRT2550099	hsa-miR-1184	CLIP-seq
MIRT2550100	hsa-miR-1205	CLIP-seq
MIRT2550101	hsa-miR-1206	CLIP-seq
MIRT2550102	hsa-miR-1207-3p	CLIP-seq
MIRT2550103	hsa-miR-1207-5p	CLIP-seq
MIRT2550104	hsa-miR-1224-5p	CLIP-seq
MIRT2550105	hsa-miR-1225-5p	CLIP-seq
MIRT2550106	hsa-miR-1237	CLIP-seq
MIRT2550107	hsa-miR-1238	CLIP-seq
MIRT1061307	hsa-miR-1245b-3p	CLIP-seq
MIRT2550108	hsa-miR-1248	CLIP-seq
MIRT2550109	hsa-miR-1251	CLIP-seq
MIRT2550110	hsa-miR-1261	CLIP-seq
MIRT2550111	hsa-miR-1264	CLIP-seq
MIRT2550112	hsa-miR-1273f	CLIP-seq
MIRT2550113	hsa-miR-1275	CLIP-seq
MIRT2550114	hsa-miR-1279	CLIP-seq
MIRT2550115	hsa-miR-128	CLIP-seq
MIRT2550116	hsa-miR-1288	CLIP-seq
MIRT2550117	hsa-miR-1289	CLIP-seq
MIRT2550118	hsa-miR-1294	CLIP-seq
MIRT2389289	hsa-miR-1304	CLIP-seq
MIRT2550119	hsa-miR-1321	CLIP-seq
MIRT2550120	hsa-miR-1322	CLIP-seq
MIRT2550121	hsa-miR-1343	CLIP-seq
MIRT2550122	hsa-miR-140-5p	CLIP-seq
MIRT2246552	hsa-miR-142-5p	CLIP-seq
MIRT2550123	hsa-miR-143	CLIP-seq
MIRT2550124	hsa-miR-1470	CLIP-seq
MIRT2550125	hsa-miR-149	CLIP-seq
MIRT2550126	hsa-miR-153	CLIP-seq
MIRT2550127	hsa-miR-154	CLIP-seq
MIRT1061309	hsa-miR-15a	CLIP-seq
MIRT1061310	hsa-miR-15b	CLIP-seq
MIRT1061311	hsa-miR-16	CLIP-seq
MIRT1061312	hsa-miR-1827	CLIP-seq
MIRT2014329	hsa-miR-18a	CLIP-seq
MIRT2014330	hsa-miR-18b	CLIP-seq
MIRT1061313	hsa-miR-1909	CLIP-seq
MIRT2550128	hsa-miR-1915	CLIP-seq
MIRT2550129	hsa-miR-192	CLIP-seq
MIRT2550130	hsa-miR-193a-5p	CLIP-seq
MIRT1061314	hsa-miR-195	CLIP-seq
MIRT2550131	hsa-miR-197	CLIP-seq
MIRT2550132	hsa-miR-1976	CLIP-seq
MIRT2550133	hsa-miR-200b	CLIP-seq
MIRT2550134	hsa-miR-200c	CLIP-seq
MIRT2550135	hsa-miR-2052	CLIP-seq
MIRT2550136	hsa-miR-2110	CLIP-seq
MIRT2550137	hsa-miR-2113	CLIP-seq
MIRT2550138	hsa-miR-2114	CLIP-seq
MIRT2550139	hsa-miR-2116	CLIP-seq
MIRT2550140	hsa-miR-215	CLIP-seq
MIRT2550141	hsa-miR-216b	CLIP-seq
MIRT2550142	hsa-miR-218	CLIP-seq
MIRT2550143	hsa-miR-219-1-3p	CLIP-seq
MIRT1061315	hsa-miR-219-2-3p	CLIP-seq
MIRT1061316	hsa-miR-24	CLIP-seq
MIRT2550144	hsa-miR-2964a-3p	CLIP-seq
MIRT1061317	hsa-miR-298	CLIP-seq
MIRT2550145	hsa-miR-3064-3p	CLIP-seq
MIRT2550146	hsa-miR-3074-5p	CLIP-seq
MIRT2550147	hsa-miR-30a	CLIP-seq
MIRT2550148	hsa-miR-30b	CLIP-seq
MIRT2550149	hsa-miR-30c	CLIP-seq
MIRT2550150	hsa-miR-30d	CLIP-seq
MIRT2550151	hsa-miR-30e	CLIP-seq
MIRT2550152	hsa-miR-3117-5p	CLIP-seq
MIRT2550153	hsa-miR-3119	CLIP-seq
MIRT2550154	hsa-miR-3120-3p	CLIP-seq
MIRT2550155	hsa-miR-3121-3p	CLIP-seq
MIRT2550156	hsa-miR-3125	CLIP-seq
MIRT2550157	hsa-miR-3130-5p	CLIP-seq
MIRT2550158	hsa-miR-3136-5p	CLIP-seq
MIRT2550159	hsa-miR-3138	CLIP-seq
MIRT2550160	hsa-miR-3140-3p	CLIP-seq
MIRT2550161	hsa-miR-3144-5p	CLIP-seq
MIRT2550162	hsa-miR-3145-3p	CLIP-seq
MIRT2550163	hsa-miR-3146	CLIP-seq
MIRT2550164	hsa-miR-3148	CLIP-seq
MIRT2550165	hsa-miR-3150a-3p	CLIP-seq
MIRT2550166	hsa-miR-3150b-3p	CLIP-seq
MIRT2550167	hsa-miR-3156-5p	CLIP-seq
MIRT2550168	hsa-miR-3158-5p	CLIP-seq
MIRT2550169	hsa-miR-3159	CLIP-seq
MIRT2550170	hsa-miR-3163	CLIP-seq
MIRT1061319	hsa-miR-3164	CLIP-seq
MIRT2550171	hsa-miR-3165	CLIP-seq
MIRT2550172	hsa-miR-3168	CLIP-seq
MIRT2550173	hsa-miR-3169	CLIP-seq
MIRT2550174	hsa-miR-3171	CLIP-seq
MIRT2550175	hsa-miR-3176	CLIP-seq
MIRT2550176	hsa-miR-3179	CLIP-seq
MIRT2550177	hsa-miR-3182	CLIP-seq
MIRT2550178	hsa-miR-3183	CLIP-seq
MIRT2550179	hsa-miR-3191	CLIP-seq
MIRT2550180	hsa-miR-3200-5p	CLIP-seq
MIRT2550181	hsa-miR-320e	CLIP-seq
MIRT2550182	hsa-miR-326	CLIP-seq
MIRT2550183	hsa-miR-329	CLIP-seq
MIRT2550184	hsa-miR-330-5p	CLIP-seq
MIRT2246556	hsa-miR-340	CLIP-seq
MIRT2550185	hsa-miR-342-3p	CLIP-seq
MIRT2550186	hsa-miR-34c-3p	CLIP-seq
MIRT2550187	hsa-miR-3545-5p	CLIP-seq
MIRT2550188	hsa-miR-3607-5p	CLIP-seq
MIRT2014331	hsa-miR-3613-3p	CLIP-seq
MIRT2550189	hsa-miR-3614-3p	CLIP-seq
MIRT2550190	hsa-miR-3617	CLIP-seq
MIRT2550191	hsa-miR-3622b-5p	CLIP-seq
MIRT2550192	hsa-miR-362-3p	CLIP-seq
MIRT2550193	hsa-miR-3646	CLIP-seq
MIRT2550194	hsa-miR-3647-3p	CLIP-seq
MIRT2550195	hsa-miR-3650	CLIP-seq
MIRT2550196	hsa-miR-3660	CLIP-seq
MIRT1061325	hsa-miR-3664-3p	CLIP-seq
MIRT2550197	hsa-miR-3671	CLIP-seq
MIRT2550198	hsa-miR-3672	CLIP-seq
MIRT2550199	hsa-miR-3675-3p	CLIP-seq
MIRT2550200	hsa-miR-3675-5p	CLIP-seq
MIRT1061326	hsa-miR-3678-3p	CLIP-seq
MIRT2550201	hsa-miR-3688-3p	CLIP-seq
MIRT2550202	hsa-miR-3689a-5p	CLIP-seq
MIRT2550203	hsa-miR-3689b	CLIP-seq
MIRT2550204	hsa-miR-3689e	CLIP-seq
MIRT2550205	hsa-miR-3689f	CLIP-seq
MIRT2550206	hsa-miR-3692	CLIP-seq
MIRT2550207	hsa-miR-369-3p	CLIP-seq
MIRT2550208	hsa-miR-377	CLIP-seq
MIRT2550209	hsa-miR-378	CLIP-seq
MIRT2550210	hsa-miR-378b	CLIP-seq
MIRT2550211	hsa-miR-378c	CLIP-seq
MIRT2550212	hsa-miR-378d	CLIP-seq
MIRT2550213	hsa-miR-378e	CLIP-seq
MIRT2550214	hsa-miR-378f	CLIP-seq
MIRT2550215	hsa-miR-378h	CLIP-seq
MIRT2550216	hsa-miR-378i	CLIP-seq
MIRT2550217	hsa-miR-380	CLIP-seq
MIRT2246558	hsa-miR-384	CLIP-seq
MIRT2550218	hsa-miR-3908	CLIP-seq
MIRT1061328	hsa-miR-3915	CLIP-seq
MIRT2550219	hsa-miR-3916	CLIP-seq
MIRT2550220	hsa-miR-3919	CLIP-seq
MIRT2550221	hsa-miR-3922-3p	CLIP-seq
MIRT2550222	hsa-miR-3924	CLIP-seq
MIRT2550223	hsa-miR-3925-5p	CLIP-seq
MIRT2246559	hsa-miR-3926	CLIP-seq
MIRT1061329	hsa-miR-3928	CLIP-seq
MIRT2550224	hsa-miR-3941	CLIP-seq
MIRT2550225	hsa-miR-3942-3p	CLIP-seq
MIRT2550226	hsa-miR-3942-5p	CLIP-seq
MIRT2014332	hsa-miR-3945	CLIP-seq
MIRT1061330	hsa-miR-3973	CLIP-seq
MIRT1061331	hsa-miR-3974	CLIP-seq
MIRT2550227	hsa-miR-3978	CLIP-seq
MIRT2550228	hsa-miR-411	CLIP-seq
MIRT2550229	hsa-miR-412	CLIP-seq
MIRT2550230	hsa-miR-422a	CLIP-seq
MIRT1061332	hsa-miR-424	CLIP-seq
MIRT2550231	hsa-miR-425	CLIP-seq
MIRT2014333	hsa-miR-4252	CLIP-seq
MIRT2550232	hsa-miR-4254	CLIP-seq
MIRT2550233	hsa-miR-4260	CLIP-seq
MIRT2550234	hsa-miR-4263	CLIP-seq
MIRT2550235	hsa-miR-4265	CLIP-seq
MIRT2550236	hsa-miR-4268	CLIP-seq
MIRT2550237	hsa-miR-4270	CLIP-seq
MIRT2550238	hsa-miR-4271	CLIP-seq
MIRT2550239	hsa-miR-4275	CLIP-seq
MIRT1061333	hsa-miR-4276	CLIP-seq
MIRT1061334	hsa-miR-4282	CLIP-seq
MIRT2550240	hsa-miR-429	CLIP-seq
MIRT2550241	hsa-miR-4294	CLIP-seq
MIRT2550242	hsa-miR-4296	CLIP-seq
MIRT1061335	hsa-miR-4302	CLIP-seq
MIRT2550243	hsa-miR-4303	CLIP-seq
MIRT1061336	hsa-miR-4307	CLIP-seq
MIRT2550244	hsa-miR-4308	CLIP-seq
MIRT2550245	hsa-miR-4313	CLIP-seq
MIRT2550246	hsa-miR-4320	CLIP-seq
MIRT2550247	hsa-miR-4322	CLIP-seq
MIRT2550248	hsa-miR-433	CLIP-seq
MIRT2550249	hsa-miR-4424	CLIP-seq
MIRT2550250	hsa-miR-4427	CLIP-seq
MIRT2550251	hsa-miR-4428	CLIP-seq
MIRT1061337	hsa-miR-4433	CLIP-seq
MIRT2550252	hsa-miR-4435	CLIP-seq
MIRT2550253	hsa-miR-4438	CLIP-seq
MIRT2550254	hsa-miR-4439	CLIP-seq
MIRT2550255	hsa-miR-4441	CLIP-seq
MIRT2550256	hsa-miR-4448	CLIP-seq
MIRT2550257	hsa-miR-4455	CLIP-seq
MIRT2550258	hsa-miR-4457	CLIP-seq
MIRT2550259	hsa-miR-4460	CLIP-seq
MIRT1061338	hsa-miR-4468	CLIP-seq
MIRT2550260	hsa-miR-4475	CLIP-seq
MIRT2550261	hsa-miR-4476	CLIP-seq
MIRT2550262	hsa-miR-4477a	CLIP-seq
MIRT2550263	hsa-miR-448	CLIP-seq
MIRT2550264	hsa-miR-4481	CLIP-seq
MIRT2550265	hsa-miR-4482	CLIP-seq
MIRT2550266	hsa-miR-4495	CLIP-seq
MIRT2550267	hsa-miR-4506	CLIP-seq
MIRT1061340	hsa-miR-450b-5p	CLIP-seq
MIRT2550268	hsa-miR-4511	CLIP-seq
MIRT2550269	hsa-miR-4513	CLIP-seq
MIRT2550270	hsa-miR-452	CLIP-seq
MIRT2550271	hsa-miR-4520a-3p	CLIP-seq
MIRT2550272	hsa-miR-4520a-5p	CLIP-seq
MIRT2550273	hsa-miR-4520b-5p	CLIP-seq
MIRT2550274	hsa-miR-4521	CLIP-seq
MIRT1061341	hsa-miR-4524	CLIP-seq
MIRT2550275	hsa-miR-4525	CLIP-seq
MIRT2550276	hsa-miR-4526	CLIP-seq
MIRT2550277	hsa-miR-4528	CLIP-seq
MIRT2550278	hsa-miR-4533	CLIP-seq
MIRT1061342	hsa-miR-4537	CLIP-seq
MIRT2550279	hsa-miR-4638-3p	CLIP-seq
MIRT2550280	hsa-miR-4639-3p	CLIP-seq
MIRT2389296	hsa-miR-4643	CLIP-seq
MIRT2550281	hsa-miR-4645-3p	CLIP-seq
MIRT2550282	hsa-miR-4652-3p	CLIP-seq
MIRT2550283	hsa-miR-4652-5p	CLIP-seq
MIRT2014334	hsa-miR-4659a-3p	CLIP-seq
MIRT2014335	hsa-miR-4659b-3p	CLIP-seq
MIRT2550284	hsa-miR-466	CLIP-seq
MIRT2550285	hsa-miR-4665-5p	CLIP-seq
MIRT2550286	hsa-miR-4666-3p	CLIP-seq
MIRT2550287	hsa-miR-4667-3p	CLIP-seq
MIRT2550288	hsa-miR-4667-5p	CLIP-seq
MIRT2014336	hsa-miR-4668-3p	CLIP-seq
MIRT2550289	hsa-miR-4670-3p	CLIP-seq
MIRT2550290	hsa-miR-4672	CLIP-seq
MIRT2550291	hsa-miR-4676-3p	CLIP-seq
MIRT2550292	hsa-miR-4677-5p	CLIP-seq
MIRT2550293	hsa-miR-4680-3p	CLIP-seq
MIRT2550294	hsa-miR-4682	CLIP-seq
MIRT2550295	hsa-miR-4684-3p	CLIP-seq
MIRT2550296	hsa-miR-4685-5p	CLIP-seq
MIRT2550297	hsa-miR-4689	CLIP-seq
MIRT1061344	hsa-miR-4690-5p	CLIP-seq
MIRT2550298	hsa-miR-4693-3p	CLIP-seq
MIRT2550299	hsa-miR-4693-5p	CLIP-seq
MIRT2550300	hsa-miR-4694-3p	CLIP-seq
MIRT1061345	hsa-miR-4695-5p	CLIP-seq
MIRT1061346	hsa-miR-4698	CLIP-seq
MIRT2550301	hsa-miR-4699-5p	CLIP-seq
MIRT2550302	hsa-miR-4700-3p	CLIP-seq
MIRT2550303	hsa-miR-4700-5p	CLIP-seq
MIRT2550304	hsa-miR-4703-5p	CLIP-seq
MIRT2550305	hsa-miR-4704-5p	CLIP-seq
MIRT2550306	hsa-miR-4708-5p	CLIP-seq
MIRT2550307	hsa-miR-4710	CLIP-seq
MIRT2550308	hsa-miR-4711-5p	CLIP-seq
MIRT2550309	hsa-miR-4712-5p	CLIP-seq
MIRT2550310	hsa-miR-4717-3p	CLIP-seq
MIRT2550311	hsa-miR-4718	CLIP-seq
MIRT2550312	hsa-miR-4719	CLIP-seq
MIRT2246560	hsa-miR-4722-5p	CLIP-seq
MIRT2550313	hsa-miR-4723-3p	CLIP-seq
MIRT2550314	hsa-miR-4723-5p	CLIP-seq
MIRT2550315	hsa-miR-4724-5p	CLIP-seq
MIRT2550316	hsa-miR-4725-3p	CLIP-seq
MIRT2550317	hsa-miR-4727-5p	CLIP-seq
MIRT2550318	hsa-miR-4731-3p	CLIP-seq
MIRT2550319	hsa-miR-4733-5p	CLIP-seq
MIRT2014337	hsa-miR-4735-3p	CLIP-seq
MIRT2550320	hsa-miR-4739	CLIP-seq
MIRT2550321	hsa-miR-4745-5p	CLIP-seq
MIRT2550322	hsa-miR-4747-5p	CLIP-seq
MIRT2550323	hsa-miR-4756-3p	CLIP-seq
MIRT2550324	hsa-miR-4756-5p	CLIP-seq
MIRT2550325	hsa-miR-4757-5p	CLIP-seq
MIRT2550326	hsa-miR-4758-5p	CLIP-seq
MIRT1061348	hsa-miR-4760-3p	CLIP-seq
MIRT2550327	hsa-miR-4763-3p	CLIP-seq
MIRT2550328	hsa-miR-4764-3p	CLIP-seq
MIRT2550329	hsa-miR-4766-3p	CLIP-seq
MIRT1061349	hsa-miR-4768-3p	CLIP-seq
MIRT2550330	hsa-miR-4768-5p	CLIP-seq
MIRT2550331	hsa-miR-4769-3p	CLIP-seq
MIRT2550332	hsa-miR-4770	CLIP-seq
MIRT2550333	hsa-miR-4773	CLIP-seq
MIRT2550334	hsa-miR-4775	CLIP-seq
MIRT2550335	hsa-miR-4779	CLIP-seq
MIRT2550336	hsa-miR-4784	CLIP-seq
MIRT2550337	hsa-miR-4786-5p	CLIP-seq
MIRT2550338	hsa-miR-4790-3p	CLIP-seq
MIRT2550339	hsa-miR-4792	CLIP-seq
MIRT2014338	hsa-miR-4793-3p	CLIP-seq
MIRT2014339	hsa-miR-4795-3p	CLIP-seq
MIRT2550340	hsa-miR-4801	CLIP-seq
MIRT1061351	hsa-miR-488	CLIP-seq
MIRT2550341	hsa-miR-490-3p	CLIP-seq
MIRT2550342	hsa-miR-493	CLIP-seq
MIRT1061352	hsa-miR-497	CLIP-seq
MIRT1061353	hsa-miR-498	CLIP-seq
MIRT2550343	hsa-miR-502-5p	CLIP-seq
MIRT1061354	hsa-miR-503	CLIP-seq
MIRT1061355	hsa-miR-507	CLIP-seq
MIRT2550344	hsa-miR-508-5p	CLIP-seq
MIRT1061356	hsa-miR-510	CLIP-seq
MIRT1061357	hsa-miR-512-5p	CLIP-seq
MIRT2550345	hsa-miR-513b	CLIP-seq
MIRT2550346	hsa-miR-513c	CLIP-seq
MIRT2550347	hsa-miR-514b-5p	CLIP-seq
MIRT1061358	hsa-miR-520g	CLIP-seq
MIRT1061359	hsa-miR-520h	CLIP-seq
MIRT2550348	hsa-miR-522	CLIP-seq
MIRT2550349	hsa-miR-526b	CLIP-seq
MIRT2550350	hsa-miR-539	CLIP-seq
MIRT2550351	hsa-miR-541	CLIP-seq
MIRT2550352	hsa-miR-545	CLIP-seq
MIRT2550353	hsa-miR-548a-3p	CLIP-seq
MIRT1061361	hsa-miR-548aa	CLIP-seq
MIRT2550354	hsa-miR-548ae	CLIP-seq
MIRT2550355	hsa-miR-548aj	CLIP-seq
MIRT2550356	hsa-miR-548am	CLIP-seq
MIRT2014340	hsa-miR-548c-3p	CLIP-seq
MIRT2550357	hsa-miR-548e	CLIP-seq
MIRT2550358	hsa-miR-548f	CLIP-seq
MIRT2550359	hsa-miR-548g	CLIP-seq
MIRT1061365	hsa-miR-548m	CLIP-seq
MIRT2550360	hsa-miR-548s	CLIP-seq
MIRT2550361	hsa-miR-548x	CLIP-seq
MIRT2550362	hsa-miR-550a	CLIP-seq
MIRT1061366	hsa-miR-557	CLIP-seq
MIRT2550363	hsa-miR-561	CLIP-seq
MIRT1061367	hsa-miR-562	CLIP-seq
MIRT2550364	hsa-miR-570	CLIP-seq
MIRT2550365	hsa-miR-571	CLIP-seq
MIRT2550366	hsa-miR-577	CLIP-seq
MIRT2550367	hsa-miR-579	CLIP-seq
MIRT2550368	hsa-miR-581	CLIP-seq
MIRT2550369	hsa-miR-583	CLIP-seq
MIRT2550370	hsa-miR-587	CLIP-seq
MIRT2550371	hsa-miR-590-3p	CLIP-seq
MIRT2550372	hsa-miR-592	CLIP-seq
MIRT2550373	hsa-miR-595	CLIP-seq
MIRT2550374	hsa-miR-599	CLIP-seq
MIRT2550375	hsa-miR-600	CLIP-seq
MIRT1061369	hsa-miR-607	CLIP-seq
MIRT2550376	hsa-miR-615-5p	CLIP-seq
MIRT2550377	hsa-miR-618	CLIP-seq
MIRT2550378	hsa-miR-624	CLIP-seq
MIRT2550379	hsa-miR-625	CLIP-seq
MIRT2550380	hsa-miR-635	CLIP-seq
MIRT2550381	hsa-miR-636	CLIP-seq
MIRT2550382	hsa-miR-637	CLIP-seq
MIRT2550383	hsa-miR-641	CLIP-seq
MIRT2550384	hsa-miR-642b	CLIP-seq
MIRT755830	hsa-miR-646	CLIP-seq
MIRT2550385	hsa-miR-651	CLIP-seq
MIRT2246564	hsa-miR-653	CLIP-seq
MIRT2550386	hsa-miR-654-5p	CLIP-seq
MIRT2550387	hsa-miR-656	CLIP-seq
MIRT1061370	hsa-miR-659	CLIP-seq
MIRT2550388	hsa-miR-661	CLIP-seq
MIRT2550389	hsa-miR-668	CLIP-seq
MIRT2550390	hsa-miR-759	CLIP-seq
MIRT2550391	hsa-miR-766	CLIP-seq
MIRT2550392	hsa-miR-767-3p	CLIP-seq
MIRT2550393	hsa-miR-769-5p	CLIP-seq
MIRT2550394	hsa-miR-770-5p	CLIP-seq
MIRT2550395	hsa-miR-889	CLIP-seq
MIRT2550396	hsa-miR-924	CLIP-seq
MIRT2246565	hsa-miR-940	CLIP-seq
MIRT2550397	hsa-miR-942	CLIP-seq
MIRT2550398	hsa-miR-943	CLIP-seq
MIRT2550109	hsa-miR-1251	CLIP-seq
MIRT2550113	hsa-miR-1275	CLIP-seq
MIRT1061312	hsa-miR-1827	CLIP-seq
MIRT2682646	hsa-miR-3153	CLIP-seq
MIRT2550169	hsa-miR-3159	CLIP-seq
MIRT2550197	hsa-miR-3671	CLIP-seq
MIRT2246559	hsa-miR-3926	CLIP-seq
MIRT1061335	hsa-miR-4302	CLIP-seq
MIRT2550266	hsa-miR-4495	CLIP-seq
MIRT1061340	hsa-miR-450b-5p	CLIP-seq
MIRT2550285	hsa-miR-4665-5p	CLIP-seq
MIRT2550297	hsa-miR-4689	CLIP-seq
MIRT1061345	hsa-miR-4695-5p	CLIP-seq
MIRT2550334	hsa-miR-4775	CLIP-seq
MIRT1061355	hsa-miR-507	CLIP-seq
MIRT2550360	hsa-miR-548s	CLIP-seq
MIRT1061366	hsa-miR-557	CLIP-seq
MIRT2550364	hsa-miR-570	CLIP-seq
MIRT2550366	hsa-miR-577	CLIP-seq
MIRT1061369	hsa-miR-607	CLIP-seq
MIRT2550379	hsa-miR-625	CLIP-seq
MIRT2550097	hsa-miR-1179	CLIP-seq
MIRT2550099	hsa-miR-1184	CLIP-seq
MIRT2550100	hsa-miR-1205	CLIP-seq
MIRT2550101	hsa-miR-1206	CLIP-seq
MIRT2550102	hsa-miR-1207-3p	CLIP-seq
MIRT2550104	hsa-miR-1224-5p	CLIP-seq
MIRT2550105	hsa-miR-1225-5p	CLIP-seq
MIRT2550106	hsa-miR-1237	CLIP-seq
MIRT2550107	hsa-miR-1238	CLIP-seq
MIRT1061307	hsa-miR-1245b-3p	CLIP-seq
MIRT2550108	hsa-miR-1248	CLIP-seq
MIRT2550109	hsa-miR-1251	CLIP-seq
MIRT2550110	hsa-miR-1261	CLIP-seq
MIRT2550111	hsa-miR-1264	CLIP-seq
MIRT2550112	hsa-miR-1273f	CLIP-seq
MIRT2550113	hsa-miR-1275	CLIP-seq
MIRT2550114	hsa-miR-1279	CLIP-seq
MIRT2550115	hsa-miR-128	CLIP-seq
MIRT2550116	hsa-miR-1288	CLIP-seq
MIRT2389289	hsa-miR-1304	CLIP-seq
MIRT2550119	hsa-miR-1321	CLIP-seq
MIRT2550120	hsa-miR-1322	CLIP-seq
MIRT2550122	hsa-miR-140-5p	CLIP-seq
MIRT2246552	hsa-miR-142-5p	CLIP-seq
MIRT2550123	hsa-miR-143	CLIP-seq
MIRT2550124	hsa-miR-1470	CLIP-seq
MIRT2550125	hsa-miR-149	CLIP-seq
MIRT2550126	hsa-miR-153	CLIP-seq
MIRT2550127	hsa-miR-154	CLIP-seq
MIRT1061309	hsa-miR-15a	CLIP-seq
MIRT1061310	hsa-miR-15b	CLIP-seq
MIRT1061311	hsa-miR-16	CLIP-seq
MIRT1061312	hsa-miR-1827	CLIP-seq
MIRT1061313	hsa-miR-1909	CLIP-seq
MIRT2550128	hsa-miR-1915	CLIP-seq
MIRT2550129	hsa-miR-192	CLIP-seq
MIRT1061314	hsa-miR-195	CLIP-seq
MIRT2550131	hsa-miR-197	CLIP-seq
MIRT2550132	hsa-miR-1976	CLIP-seq
MIRT2550133	hsa-miR-200b	CLIP-seq
MIRT2550134	hsa-miR-200c	CLIP-seq
MIRT2550135	hsa-miR-2052	CLIP-seq
MIRT2550136	hsa-miR-2110	CLIP-seq
MIRT2550137	hsa-miR-2113	CLIP-seq
MIRT2550138	hsa-miR-2114	CLIP-seq
MIRT2550140	hsa-miR-215	CLIP-seq
MIRT2550141	hsa-miR-216b	CLIP-seq
MIRT2550142	hsa-miR-218	CLIP-seq
MIRT2550143	hsa-miR-219-1-3p	CLIP-seq
MIRT1061315	hsa-miR-219-2-3p	CLIP-seq
MIRT2550144	hsa-miR-2964a-3p	CLIP-seq
MIRT1061317	hsa-miR-298	CLIP-seq
MIRT2550145	hsa-miR-3064-3p	CLIP-seq
MIRT2550147	hsa-miR-30a	CLIP-seq
MIRT2550148	hsa-miR-30b	CLIP-seq
MIRT2550149	hsa-miR-30c	CLIP-seq
MIRT2550150	hsa-miR-30d	CLIP-seq
MIRT2550151	hsa-miR-30e	CLIP-seq
MIRT2550152	hsa-miR-3117-5p	CLIP-seq
MIRT2550153	hsa-miR-3119	CLIP-seq
MIRT2550154	hsa-miR-3120-3p	CLIP-seq
MIRT2550155	hsa-miR-3121-3p	CLIP-seq
MIRT2550156	hsa-miR-3125	CLIP-seq
MIRT2550157	hsa-miR-3130-5p	CLIP-seq
MIRT2550158	hsa-miR-3136-5p	CLIP-seq
MIRT2550159	hsa-miR-3138	CLIP-seq
MIRT2550160	hsa-miR-3140-3p	CLIP-seq
MIRT2550161	hsa-miR-3144-5p	CLIP-seq
MIRT2550162	hsa-miR-3145-3p	CLIP-seq
MIRT2550163	hsa-miR-3146	CLIP-seq
MIRT2550165	hsa-miR-3150a-3p	CLIP-seq
MIRT2550166	hsa-miR-3150b-3p	CLIP-seq
MIRT2550168	hsa-miR-3158-5p	CLIP-seq
MIRT2550169	hsa-miR-3159	CLIP-seq
MIRT2550170	hsa-miR-3163	CLIP-seq
MIRT1061319	hsa-miR-3164	CLIP-seq
MIRT2550171	hsa-miR-3165	CLIP-seq
MIRT2550173	hsa-miR-3169	CLIP-seq
MIRT2550176	hsa-miR-3179	CLIP-seq
MIRT2550177	hsa-miR-3182	CLIP-seq
MIRT2550178	hsa-miR-3183	CLIP-seq
MIRT2550179	hsa-miR-3191	CLIP-seq
MIRT2550180	hsa-miR-3200-5p	CLIP-seq
MIRT2550181	hsa-miR-320e	CLIP-seq
MIRT2550182	hsa-miR-326	CLIP-seq
MIRT2550183	hsa-miR-329	CLIP-seq
MIRT2550184	hsa-miR-330-5p	CLIP-seq
MIRT2246556	hsa-miR-340	CLIP-seq
MIRT2550186	hsa-miR-34c-3p	CLIP-seq
MIRT2550187	hsa-miR-3545-5p	CLIP-seq
MIRT2550188	hsa-miR-3607-5p	CLIP-seq
MIRT2014331	hsa-miR-3613-3p	CLIP-seq
MIRT2550189	hsa-miR-3614-3p	CLIP-seq
MIRT2550190	hsa-miR-3617	CLIP-seq
MIRT2550191	hsa-miR-3622b-5p	CLIP-seq
MIRT2550192	hsa-miR-362-3p	CLIP-seq
MIRT2550193	hsa-miR-3646	CLIP-seq
MIRT2550194	hsa-miR-3647-3p	CLIP-seq
MIRT2550195	hsa-miR-3650	CLIP-seq
MIRT1061325	hsa-miR-3664-3p	CLIP-seq
MIRT2550197	hsa-miR-3671	CLIP-seq
MIRT2550199	hsa-miR-3675-3p	CLIP-seq
MIRT2550200	hsa-miR-3675-5p	CLIP-seq
MIRT1061326	hsa-miR-3678-3p	CLIP-seq
MIRT2550201	hsa-miR-3688-3p	CLIP-seq
MIRT2550202	hsa-miR-3689a-5p	CLIP-seq
MIRT2550203	hsa-miR-3689b	CLIP-seq
MIRT2550204	hsa-miR-3689e	CLIP-seq
MIRT2550205	hsa-miR-3689f	CLIP-seq
MIRT2550206	hsa-miR-3692	CLIP-seq
MIRT2550207	hsa-miR-369-3p	CLIP-seq
MIRT2550208	hsa-miR-377	CLIP-seq
MIRT2550209	hsa-miR-378	CLIP-seq
MIRT2550210	hsa-miR-378b	CLIP-seq
MIRT2550211	hsa-miR-378c	CLIP-seq
MIRT2550212	hsa-miR-378d	CLIP-seq
MIRT2550213	hsa-miR-378e	CLIP-seq
MIRT2550214	hsa-miR-378f	CLIP-seq
MIRT2550215	hsa-miR-378h	CLIP-seq
MIRT2550216	hsa-miR-378i	CLIP-seq
MIRT2550217	hsa-miR-380	CLIP-seq
MIRT2246558	hsa-miR-384	CLIP-seq
MIRT2550218	hsa-miR-3908	CLIP-seq
MIRT1061328	hsa-miR-3915	CLIP-seq
MIRT2550219	hsa-miR-3916	CLIP-seq
MIRT2550220	hsa-miR-3919	CLIP-seq
MIRT2550222	hsa-miR-3924	CLIP-seq
MIRT2550223	hsa-miR-3925-5p	CLIP-seq
MIRT2246559	hsa-miR-3926	CLIP-seq
MIRT1061329	hsa-miR-3928	CLIP-seq
MIRT2550224	hsa-miR-3941	CLIP-seq
MIRT2550225	hsa-miR-3942-3p	CLIP-seq
MIRT2550226	hsa-miR-3942-5p	CLIP-seq
MIRT2014332	hsa-miR-3945	CLIP-seq
MIRT1061330	hsa-miR-3973	CLIP-seq
MIRT1061331	hsa-miR-3974	CLIP-seq
MIRT2550227	hsa-miR-3978	CLIP-seq
MIRT2550228	hsa-miR-411	CLIP-seq
MIRT2550230	hsa-miR-422a	CLIP-seq
MIRT1061332	hsa-miR-424	CLIP-seq
MIRT2550231	hsa-miR-425	CLIP-seq
MIRT2014333	hsa-miR-4252	CLIP-seq
MIRT2550232	hsa-miR-4254	CLIP-seq
MIRT2550233	hsa-miR-4260	CLIP-seq
MIRT2550234	hsa-miR-4263	CLIP-seq
MIRT2550235	hsa-miR-4265	CLIP-seq
MIRT2550236	hsa-miR-4268	CLIP-seq
MIRT2550237	hsa-miR-4270	CLIP-seq
MIRT2550238	hsa-miR-4271	CLIP-seq
MIRT2550239	hsa-miR-4275	CLIP-seq
MIRT1061333	hsa-miR-4276	CLIP-seq
MIRT1061334	hsa-miR-4282	CLIP-seq
MIRT2550240	hsa-miR-429	CLIP-seq
MIRT2550241	hsa-miR-4294	CLIP-seq
MIRT2550242	hsa-miR-4296	CLIP-seq
MIRT1061335	hsa-miR-4302	CLIP-seq
MIRT2550243	hsa-miR-4303	CLIP-seq
MIRT2550244	hsa-miR-4308	CLIP-seq
MIRT2550245	hsa-miR-4313	CLIP-seq
MIRT2550246	hsa-miR-4320	CLIP-seq
MIRT2550247	hsa-miR-4322	CLIP-seq
MIRT2550248	hsa-miR-433	CLIP-seq
MIRT2550249	hsa-miR-4424	CLIP-seq
MIRT2550250	hsa-miR-4427	CLIP-seq
MIRT2550251	hsa-miR-4428	CLIP-seq
MIRT1061337	hsa-miR-4433	CLIP-seq
MIRT2550252	hsa-miR-4435	CLIP-seq
MIRT2550253	hsa-miR-4438	CLIP-seq
MIRT2550254	hsa-miR-4439	CLIP-seq
MIRT2550255	hsa-miR-4441	CLIP-seq
MIRT2550256	hsa-miR-4448	CLIP-seq
MIRT2550259	hsa-miR-4460	CLIP-seq
MIRT1061338	hsa-miR-4468	CLIP-seq
MIRT2550260	hsa-miR-4475	CLIP-seq
MIRT2550261	hsa-miR-4476	CLIP-seq
MIRT2550262	hsa-miR-4477a	CLIP-seq
MIRT2550263	hsa-miR-448	CLIP-seq
MIRT2550264	hsa-miR-4481	CLIP-seq
MIRT2550265	hsa-miR-4482	CLIP-seq
MIRT2550266	hsa-miR-4495	CLIP-seq
MIRT1061339	hsa-miR-4496	CLIP-seq
MIRT2550267	hsa-miR-4506	CLIP-seq
MIRT1061340	hsa-miR-450b-5p	CLIP-seq
MIRT2550268	hsa-miR-4511	CLIP-seq
MIRT2550269	hsa-miR-4513	CLIP-seq
MIRT2550271	hsa-miR-4520a-3p	CLIP-seq
MIRT2550272	hsa-miR-4520a-5p	CLIP-seq
MIRT2550273	hsa-miR-4520b-5p	CLIP-seq
MIRT1061341	hsa-miR-4524	CLIP-seq
MIRT2550275	hsa-miR-4525	CLIP-seq
MIRT2550277	hsa-miR-4528	CLIP-seq
MIRT2550278	hsa-miR-4533	CLIP-seq
MIRT1061342	hsa-miR-4537	CLIP-seq
MIRT2550279	hsa-miR-4638-3p	CLIP-seq
MIRT2550281	hsa-miR-4645-3p	CLIP-seq
MIRT2550282	hsa-miR-4652-3p	CLIP-seq
MIRT2550283	hsa-miR-4652-5p	CLIP-seq
MIRT2014334	hsa-miR-4659a-3p	CLIP-seq
MIRT2014335	hsa-miR-4659b-3p	CLIP-seq
MIRT2550284	hsa-miR-466	CLIP-seq
MIRT2550285	hsa-miR-4665-5p	CLIP-seq
MIRT2550287	hsa-miR-4667-3p	CLIP-seq
MIRT2550288	hsa-miR-4667-5p	CLIP-seq
MIRT2014336	hsa-miR-4668-3p	CLIP-seq
MIRT2550290	hsa-miR-4672	CLIP-seq
MIRT2550294	hsa-miR-4682	CLIP-seq
MIRT2550295	hsa-miR-4684-3p	CLIP-seq
MIRT2550296	hsa-miR-4685-5p	CLIP-seq
MIRT2550297	hsa-miR-4689	CLIP-seq
MIRT1061344	hsa-miR-4690-5p	CLIP-seq
MIRT2550298	hsa-miR-4693-3p	CLIP-seq
MIRT2550300	hsa-miR-4694-3p	CLIP-seq
MIRT1061345	hsa-miR-4695-5p	CLIP-seq
MIRT1061346	hsa-miR-4698	CLIP-seq
MIRT2550301	hsa-miR-4699-5p	CLIP-seq
MIRT2550302	hsa-miR-4700-3p	CLIP-seq
MIRT2550303	hsa-miR-4700-5p	CLIP-seq
MIRT2550304	hsa-miR-4703-5p	CLIP-seq
MIRT2550305	hsa-miR-4704-5p	CLIP-seq
MIRT2550306	hsa-miR-4708-5p	CLIP-seq
MIRT2550307	hsa-miR-4710	CLIP-seq
MIRT2550308	hsa-miR-4711-5p	CLIP-seq
MIRT2550309	hsa-miR-4712-5p	CLIP-seq
MIRT2246560	hsa-miR-4722-5p	CLIP-seq
MIRT2550313	hsa-miR-4723-3p	CLIP-seq
MIRT2550314	hsa-miR-4723-5p	CLIP-seq
MIRT2550315	hsa-miR-4724-5p	CLIP-seq
MIRT2550316	hsa-miR-4725-3p	CLIP-seq
MIRT2550317	hsa-miR-4727-5p	CLIP-seq
MIRT2550318	hsa-miR-4731-3p	CLIP-seq
MIRT2550320	hsa-miR-4739	CLIP-seq
MIRT2550321	hsa-miR-4745-5p	CLIP-seq
MIRT2550323	hsa-miR-4756-3p	CLIP-seq
MIRT2550324	hsa-miR-4756-5p	CLIP-seq
MIRT2550326	hsa-miR-4758-5p	CLIP-seq
MIRT1061348	hsa-miR-4760-3p	CLIP-seq
MIRT2550329	hsa-miR-4766-3p	CLIP-seq
MIRT1061349	hsa-miR-4768-3p	CLIP-seq
MIRT2550330	hsa-miR-4768-5p	CLIP-seq
MIRT2550331	hsa-miR-4769-3p	CLIP-seq
MIRT2550332	hsa-miR-4770	CLIP-seq
MIRT2550333	hsa-miR-4773	CLIP-seq
MIRT2550334	hsa-miR-4775	CLIP-seq
MIRT2550336	hsa-miR-4784	CLIP-seq
MIRT2550337	hsa-miR-4786-5p	CLIP-seq
MIRT2550338	hsa-miR-4790-3p	CLIP-seq
MIRT2550339	hsa-miR-4792	CLIP-seq
MIRT2014338	hsa-miR-4793-3p	CLIP-seq
MIRT2014339	hsa-miR-4795-3p	CLIP-seq
MIRT2550340	hsa-miR-4801	CLIP-seq
MIRT1061351	hsa-miR-488	CLIP-seq
MIRT2550341	hsa-miR-490-3p	CLIP-seq
MIRT2550342	hsa-miR-493	CLIP-seq
MIRT1061352	hsa-miR-497	CLIP-seq
MIRT1061353	hsa-miR-498	CLIP-seq
MIRT2550343	hsa-miR-502-5p	CLIP-seq
MIRT1061354	hsa-miR-503	CLIP-seq
MIRT1061355	hsa-miR-507	CLIP-seq
MIRT2550344	hsa-miR-508-5p	CLIP-seq
MIRT1061356	hsa-miR-510	CLIP-seq
MIRT1061357	hsa-miR-512-5p	CLIP-seq
MIRT2550345	hsa-miR-513b	CLIP-seq
MIRT2550346	hsa-miR-513c	CLIP-seq
MIRT2550347	hsa-miR-514b-5p	CLIP-seq
MIRT1061358	hsa-miR-520g	CLIP-seq
MIRT1061359	hsa-miR-520h	CLIP-seq
MIRT2550348	hsa-miR-522	CLIP-seq
MIRT2550349	hsa-miR-526b	CLIP-seq
MIRT2550350	hsa-miR-539	CLIP-seq
MIRT2550351	hsa-miR-541	CLIP-seq
MIRT2550352	hsa-miR-545	CLIP-seq
MIRT2550353	hsa-miR-548a-3p	CLIP-seq
MIRT1061361	hsa-miR-548aa	CLIP-seq
MIRT2550354	hsa-miR-548ae	CLIP-seq
MIRT2550355	hsa-miR-548aj	CLIP-seq
MIRT2550356	hsa-miR-548am	CLIP-seq
MIRT2014340	hsa-miR-548c-3p	CLIP-seq
MIRT2550357	hsa-miR-548e	CLIP-seq
MIRT2550358	hsa-miR-548f	CLIP-seq
MIRT2550359	hsa-miR-548g	CLIP-seq
MIRT1061365	hsa-miR-548m	CLIP-seq
MIRT2550360	hsa-miR-548s	CLIP-seq
MIRT2550361	hsa-miR-548x	CLIP-seq
MIRT2550362	hsa-miR-550a	CLIP-seq
MIRT1061366	hsa-miR-557	CLIP-seq
MIRT2550363	hsa-miR-561	CLIP-seq
MIRT1061367	hsa-miR-562	CLIP-seq
MIRT2550364	hsa-miR-570	CLIP-seq
MIRT2550365	hsa-miR-571	CLIP-seq
MIRT2550366	hsa-miR-577	CLIP-seq
MIRT2550367	hsa-miR-579	CLIP-seq
MIRT2550368	hsa-miR-581	CLIP-seq
MIRT2550370	hsa-miR-587	CLIP-seq
MIRT2550371	hsa-miR-590-3p	CLIP-seq
MIRT2550372	hsa-miR-592	CLIP-seq
MIRT2550374	hsa-miR-599	CLIP-seq
MIRT2550375	hsa-miR-600	CLIP-seq
MIRT1061369	hsa-miR-607	CLIP-seq
MIRT2550376	hsa-miR-615-5p	CLIP-seq
MIRT2550379	hsa-miR-625	CLIP-seq
MIRT2550381	hsa-miR-636	CLIP-seq
MIRT2550382	hsa-miR-637	CLIP-seq
MIRT2550383	hsa-miR-641	CLIP-seq
MIRT2550384	hsa-miR-642b	CLIP-seq
MIRT755830	hsa-miR-646	CLIP-seq
MIRT2550385	hsa-miR-651	CLIP-seq
MIRT2246564	hsa-miR-653	CLIP-seq
MIRT2550386	hsa-miR-654-5p	CLIP-seq
MIRT2550387	hsa-miR-656	CLIP-seq
MIRT1061370	hsa-miR-659	CLIP-seq
MIRT2550388	hsa-miR-661	CLIP-seq
MIRT2550390	hsa-miR-759	CLIP-seq
MIRT2550391	hsa-miR-766	CLIP-seq
MIRT2550392	hsa-miR-767-3p	CLIP-seq
MIRT2550393	hsa-miR-769-5p	CLIP-seq
MIRT2550394	hsa-miR-770-5p	CLIP-seq
MIRT2550395	hsa-miR-889	CLIP-seq
MIRT2550396	hsa-miR-924	CLIP-seq
MIRT2246565	hsa-miR-940	CLIP-seq
MIRT2550397	hsa-miR-942	CLIP-seq
MIRT2550398	hsa-miR-943	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
BRCA1	Repression	18045956
CEBPA	Activation	7708053
EP300	Unknown	18281476
HDAC2	Unknown	18193094
NCOR1	Unknown	18193094
NCOR2	Unknown	18193094
OTX2	Activation	21047732
RB1	Unknown	18281476
STAT5B	Activation	22419735
WT1	Repression	9076342

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001501	Process	Skeletal system development	TAS	10448861
GO:0001649	Process	Osteoblast differentiation	IEA
GO:0001775	Process	Cell activation	IDA	22797923
GO:0001837	Process	Epithelial to mesenchymal transition	NAS	26944318
GO:0001974	Process	Blood vessel remodeling	IEA
GO:0005158	Function	Insulin receptor binding	IEA
GO:0005158	Function	Insulin receptor binding	IPI	8452530
GO:0005159	Function	Insulin-like growth factor receptor binding	IBA
GO:0005159	Function	Insulin-like growth factor receptor binding	IDA	19578119
GO:0005159	Function	Insulin-like growth factor receptor binding	IEA
GO:0005159	Function	Insulin-like growth factor receptor binding	IMP	1847964, 2967174
GO:0005159	Function	Insulin-like growth factor receptor binding	IPI	8452530
GO:0005178	Function	Integrin binding	IDA	19578119, 22351760
GO:0005179	Function	Hormone activity	IBA
GO:0005179	Function	Hormone activity	IDA	7188854
GO:0005179	Function	Hormone activity	IEA
GO:0005179	Function	Hormone activity	TAS	9681507
GO:0005515	Function	Protein binding	IPI	8452530, 10766744, 15642270, 16924115, 21645859, 22578544, 26027733, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	NAS	14718574
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	7188854, 11404306, 17119061, 25152160
GO:0005615	Component	Extracellular space	IEA
GO:0007165	Process	Signal transduction	TAS	10448861
GO:0007265	Process	Ras protein signal transduction	TAS	10848592
GO:0007399	Process	Nervous system development	IEA
GO:0007517	Process	Muscle organ development	TAS	10448861
GO:0007623	Process	Circadian rhythm	IEA
GO:0008083	Function	Growth factor activity	IDA	9722506
GO:0008083	Function	Growth factor activity	IEA
GO:0008283	Process	Cell population proliferation	IBA
GO:0008283	Process	Cell population proliferation	IEA
GO:0008283	Process	Cell population proliferation	IMP	1847964, 9714146
GO:0008284	Process	Positive regulation of cell population proliferation	IBA
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	7688386, 9722506, 12746903
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	19578119
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0008286	Process	Insulin receptor signaling pathway	IDA	22635104
GO:0009408	Process	Response to heat	IDA	11404306
GO:0009441	Process	Glycolate metabolic process	TAS	10448861
GO:0010001	Process	Glial cell differentiation	IEA
GO:0010468	Process	Regulation of gene expression	IMP	21543511
GO:0010560	Process	Positive regulation of glycoprotein biosynthetic process	IMP	9564845
GO:0010613	Process	Positive regulation of cardiac muscle hypertrophy	IDA	19654000
GO:0010613	Process	Positive regulation of cardiac muscle hypertrophy	IMP	19933931
GO:0010628	Process	Positive regulation of gene expression	IGI	22635104
GO:0010629	Process	Negative regulation of gene expression	IDA	29167509
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0014834	Process	Skeletal muscle satellite cell maintenance involved in skeletal muscle regeneration	IDA	17531227
GO:0014896	Process	Muscle hypertrophy	IMP	10191278
GO:0014902	Process	Myotube differentiation	IEA
GO:0014904	Process	Myotube cell development	IDA	17531227
GO:0014911	Process	Positive regulation of smooth muscle cell migration	IDA	10766744
GO:0016942	Component	Insulin-like growth factor binding protein complex	IC	10766744
GO:0021930	Process	Cerebellar granule cell precursor proliferation	IEA
GO:0021940	Process	Positive regulation of cerebellar granule cell precursor proliferation	IEA
GO:0030141	Component	Secretory granule	IEA
GO:0030166	Process	Proteoglycan biosynthetic process	IDA	12746903
GO:0030166	Process	Proteoglycan biosynthetic process	IMP	9564845
GO:0030295	Function	Protein kinase activator activity	IEA
GO:0030297	Function	Transmembrane receptor protein tyrosine kinase activator activity	IDA	9722506
GO:0030297	Function	Transmembrane receptor protein tyrosine kinase activator activity	IEA
GO:0030324	Process	Lung development	IEA
GO:0030335	Process	Positive regulation of cell migration	IMP	24508636
GO:0030521	Process	Androgen receptor signaling pathway	IEA
GO:0030879	Process	Mammary gland development	IEA
GO:0031017	Process	Exocrine pancreas development	IEA
GO:0031093	Component	Platelet alpha granule lumen	TAS
GO:0031643	Process	Positive regulation of myelination	IEA
GO:0032148	Process	Activation of protein kinase B activity	IMP	22351760
GO:0032691	Process	Negative regulation of interleukin-1 beta production	IGI	27277332
GO:0032720	Process	Negative regulation of tumor necrosis factor production	IGI	27277332
GO:0032878	Process	Regulation of establishment or maintenance of cell polarity	IEA
GO:0034392	Process	Negative regulation of smooth muscle cell apoptotic process	IDA	16942485
GO:0035264	Process	Multicellular organism growth	IEA
GO:0035630	Process	Bone mineralization involved in bone maturation	IDA	16433617
GO:0035867	Component	Alphav-beta3 integrin-IGF-1-IGF1R complex	IDA	19578119
GO:0042060	Process	Wound healing	IDA	17531227
GO:0042104	Process	Positive regulation of activated T cell proliferation	IDA	15694994
GO:0042567	Component	Insulin-like growth factor ternary complex	IDA	9497324
GO:0043066	Process	Negative regulation of apoptotic process	IBA
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IMP	11949853
GO:0043388	Process	Positive regulation of DNA binding	IDA	19654000
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	19654000
GO:0043491	Process	Phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0043568	Process	Positive regulation of insulin-like growth factor receptor signaling pathway	IDA	7688386, 10766744
GO:0044342	Process	Type B pancreatic cell proliferation	IEA
GO:0045428	Process	Regulation of nitric oxide biosynthetic process	IEA
GO:0045445	Process	Myoblast differentiation	IDA	17531227
GO:0045669	Process	Positive regulation of osteoblast differentiation	IDA	16433617
GO:0045725	Process	Positive regulation of glycogen biosynthetic process	IDA	21076856
GO:0045821	Process	Positive regulation of glycolytic process	IDA	7688386
GO:0045840	Process	Positive regulation of mitotic nuclear division	IDA	7188854, 10644978
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	9722506, 19654000
GO:0045893	Process	Positive regulation of DNA-templated transcription	IMP	15059951
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	16433617
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046326	Process	Positive regulation of D-glucose import	IDA	21076856
GO:0046579	Process	Positive regulation of Ras protein signal transduction	IDA	9722506
GO:0048009	Process	Insulin-like growth factor receptor signaling pathway	IBA
GO:0048009	Process	Insulin-like growth factor receptor signaling pathway	IDA	7679099, 17827393
GO:0048009	Process	Insulin-like growth factor receptor signaling pathway	IDA	7692086, 7782332, 9722506
GO:0048009	Process	Insulin-like growth factor receptor signaling pathway	IEA
GO:0048009	Process	Insulin-like growth factor receptor signaling pathway	IMP	19578119, 22351760
GO:0048009	Process	Insulin-like growth factor receptor signaling pathway	IPI	7541045
GO:0048018	Function	Receptor ligand activity	IEA
GO:0048146	Process	Positive regulation of fibroblast proliferation	IDA	7188854
GO:0048286	Process	Lung alveolus development	IEA
GO:0048468	Process	Cell development	IEA
GO:0048661	Process	Positive regulation of smooth muscle cell proliferation	IDA	10766744, 16942485
GO:0048754	Process	Branching morphogenesis of an epithelial tube	IEA
GO:0048839	Process	Inner ear development	IEA
GO:0050650	Process	Chondroitin sulfate proteoglycan biosynthetic process	IEA
GO:0050679	Process	Positive regulation of epithelial cell proliferation	IDA	7188854
GO:0050679	Process	Positive regulation of epithelial cell proliferation	IEA
GO:0050714	Process	Positive regulation of protein secretion	IMP	9564845
GO:0050821	Process	Protein stabilization	IMP	9564845
GO:0051246	Process	Regulation of protein metabolic process	IEA
GO:0051450	Process	Myoblast proliferation	IDA	17531227
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IBA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	7688386, 7692086
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IMP	19057511, 24508636
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	NAS	26944318
GO:0060283	Process	Negative regulation of oocyte development	IMP	21543511
GO:0060396	Process	Growth hormone receptor signaling pathway	IMP	19057511
GO:0060426	Process	Lung vasculature development	IEA
GO:0060463	Process	Lung lobe morphogenesis	IEA
GO:0060509	Process	Type I pneumocyte differentiation	IEA
GO:0060510	Process	Type II pneumocyte differentiation	IEA
GO:0060527	Process	Prostate epithelial cord arborization involved in prostate glandular acinus morphogenesis	IEA
GO:0060736	Process	Prostate gland growth	IEA
GO:0060740	Process	Prostate gland epithelium morphogenesis	IEA
GO:0060741	Process	Prostate gland stromal morphogenesis	IEA
GO:0060766	Process	Negative regulation of androgen receptor signaling pathway	IEA
GO:0061051	Process	Positive regulation of cell growth involved in cardiac muscle cell development	IDA	24117217
GO:0061051	Process	Positive regulation of cell growth involved in cardiac muscle cell development	IGI	24117217
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IMP	19578119, 24508636
GO:0070382	Component	Exocytic vesicle	IEA
GO:0070382	Component	Exocytic vesicle	ISS
GO:0070886	Process	Positive regulation of calcineurin-NFAT signaling cascade	IDA	19654000
GO:0071333	Process	Cellular response to glucose stimulus	IEA
GO:0090201	Process	Negative regulation of release of cytochrome c from mitochondria	IEA
GO:0090201	Process	Negative regulation of release of cytochrome c from mitochondria	ISS
GO:0097192	Process	Extrinsic apoptotic signaling pathway in absence of ligand	IEA
GO:0097696	Process	Cell surface receptor signaling pathway via STAT	IDA	9722506
GO:0098794	Component	Postsynapse	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099013	Component	Neuronal dense core vesicle lumen	IEA
GO:0099170	Process	Postsynaptic modulation of chemical synaptic transmission	IEA
GO:0150079	Process	Negative regulation of neuroinflammatory response	IGI	27277332
GO:1902430	Process	Negative regulation of amyloid-beta formation	IGI	27277332
GO:1904075	Process	Positive regulation of trophectodermal cell proliferation	IMP	24508636
GO:1904646	Process	Cellular response to amyloid-beta	IGI	22635104
GO:1904692	Process	Positive regulation of type B pancreatic cell proliferation	IEA
GO:1904707	Process	Positive regulation of vascular associated smooth muscle cell proliferation	IMP	26166810
GO:1905460	Process	Negative regulation of vascular associated smooth muscle cell apoptotic process	IMP	26166810
GO:1990314	Process	Cellular response to insulin-like growth factor stimulus	IEA
GO:2000288	Process	Positive regulation of myoblast proliferation	IEA
GO:2000679	Process	Positive regulation of transcription regulatory region DNA binding	IDA	15059951
GO:2001234	Process	Negative regulation of apoptotic signaling pathway	IEA
GO:2001237	Process	Negative regulation of extrinsic apoptotic signaling pathway	IDA	16942485

Other IDs

• MIM: 147440
• HGNC: 5464
• e!Ensembl: ENSG00000017427

Protein

• UniProt ID: P05019
• Protein name: Insulin-like growth factor 1 (Insulin-like growth factor I) (IGF-I) (Mechano growth factor) (MGF) (Somatomedin-C)
• Protein function: The insulin-like growth factors, isolated from plasma, are structurally and functionally related to insulin but have a much higher growth-promoting activity. May be a physiological regulator of [1-14C]-2-deoxy-D-glucose (2DG) transport and glyco
• PDB: 1B9G, 1BQT, 1GZR, 1GZY, 1GZZ, 1H02, 1H59, 1IMX, 1PMX, 1TGR, 1WQJ, 2DSP, 2DSQ, 2DSR, 2GF1, 3GF1, 3LRI, 4XSS, 5U8Q, 6FF3, 6PYH, 6RVA, 7S0Q, 7WRQ, 7YRR, 8EYR, 8X06, 8X2M, 8XJS, 8XK1, 8XKM, 8XKR
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00049	Insulin	51 → 109	Insulin/IGF/Relaxin family	Domain

• Sequence:

  MGKISSLPTQLFKCCFCDFLKVKMHTMSSSHLFYLALCLLTFTSSATAGPETLCGAELVD
  ALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARS
  VRAQRHTDMPKTQKYQPPSTNKNTKSQRRKGWPKTHPGGEQKEGTEASLQIRGKKKEQRR
  EIGSRNAECRGKKGK

• Sequence length: 195

Pathways

KEGG:

EGFR tyrosine kinase inhibitor resistance
Endocrine resistance
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
HIF-1 signaling pathway
FoxO signaling pathway
Hormone signaling
Oocyte meiosis
p53 signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Longevity regulating pathway
Longevity regulating pathway - multiple species
Focal adhesion
Signaling pathways regulating pluripotency of stem cells
Long-term depression
Inflammatory mediator regulation of TRP channels
Ovarian steroidogenesis
Progesterone-mediated oocyte maturation
Growth hormone synthesis, secretion and action
Aldosterone-regulated sodium reabsorption
Pathways in cancer
Transcriptional misregulation in cancer
Proteoglycans in cancer
Glioma
Prostate cancer
Melanoma
Breast cancer
Hypertrophic cardiomyopathy
Dilated cardiomyopathy

Reactome:

Platelet degranulation
Signaling by Type 1 Insulin-like Growth Factor 1 Receptor (IGF1R)
IRS-related events triggered by IGF1R
SHC-related events triggered by IGF1R
Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
Synthesis, secretion, and deacylation of Ghrelin

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Growth delay due to insulin-like growth factor type 1 deficiency	Likely pathogenic	rs1592837549, rs3730193	RCV001007823 RCV001029775	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMERS DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISTIC DISORDER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BONE DISEASES, METABOLIC	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN ISCHEMIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CACHEXIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMEGALY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHY, DILATED	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLESTASIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLITIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORNEAL DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN DISEASE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHNS DISEASE OF LARGE BOWEL	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DELIRIUM	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMYELINATING DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DENTAL CARIES	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DESBUQUOIS SYNDROME	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, INSULIN-DEPENDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, TYPE 1	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC CARDIOMYOPATHIES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC RETINOPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESSENTIAL TREMOR	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FEMALE UROGENITAL DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HUNTINGTON DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERALGESIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IGF1-related disorder	Uncertain significance; Likely benign; Benign; Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intellectual disability	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, ACUTE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, CHRONIC	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEARNING DISABILITIES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEARNING DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MEMORY DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC BONE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Microcephaly	Uncertain significance	ClinVar Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
MOVEMENT DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOPIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-NEOPLASTIC PERIPHERAL NERVOUS SYSTEM DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPEN-ANGLE GLAUCOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL NERVOUS SYSTEM DISEASES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL NEUROPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PITUITARY NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY FIBROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA OF HEAD AND NECK	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY BLADDER NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UTERINE FIBROID	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
22q13.3 Deletion Syndrome	22q13.3 deletion syndrome	BEFREE	24132240		★☆☆☆☆ Found in Text Mining only
Achondroplasia	Achondroplasia	BEFREE	14671399		★☆☆☆☆ Found in Text Mining only
Acne	Acne	BEFREE	23457723, 28677193, 28677199, 30192343, 30859308		★☆☆☆☆ Found in Text Mining only
Acne Vulgaris	Acne	BEFREE	23457723, 30859308		★☆☆☆☆ Found in Text Mining only
Acromegaly	Acromegaly	Pubtator	11404775, 17373589, 21908929, 27070751, 27503591, 29266696, 30742299, 31771524, 34027406	Stimulate	★☆☆☆☆ Found in Text Mining only
Acromegaly	Acromegaly	BEFREE	12372843, 12915690, 15914528, 16262568, 17003099, 17573420, 17913341, 19336510, 19439509, 20234189, 20447065, 20920870, 21550080, 22364960, 22370764, 23648743, 24092547, 24144967, 24382376, 24937542, 25329702, 25370837, 25385818, 26243033, 26448623, 26610414, 26873451, 27161443, 27492731, 27518527, 27568329, 27578200, 27631335, 27681883, 27858572, 27913611, 27974387, 27998919, 28012070, 28025719, 28077497, 28127733, 28150161, 28168377, 28341329, 28357781, 28372721, 28390436, 28419317, 28611056, 28620866, 28660605, 28808855, 28879646, 28881863, 28898247, 28945897, 28951345, 28993415, 29113856, 29198552, 29218459, 29222208, 29290044, 29305680, 29318448, 29353224, 29374071, 29388045, 29429125, 29479042, 29542030, 29569265, 29593792, 29605877, 29642245, 29728863, 29789410, 29890543, 29895074, 29931465, 29949429, 29971605, 30034367, 30048170, 30076159, 30141524, 30184064, 30311754, 30343638, 30397873, 30476255, 30482010, 30500870, 30548674, 30555420, 30619084, 30620709, 30627944, 30640713, 30653179, 30742299, 30745501, 30772778, 30818110, 30843181, 30843342, 30851160, 31071497, 31185505, 31361303, 31396153, 31520541, 31561638, 31673954, 31741320, 31751301, 31755099, 31821453, 7704960, 8432778, 8838774, 9024241, 9348175		★☆☆☆☆ Found in Text Mining only
Acromegaly	Acromegaly	Pubtator	12604504, 16543670, 19293545, 23291436, 23648743, 26087292, 26448623, 27982199, 28977166, 30843342, 32079542, 34081617, 36973824, 37446150	Associate	★☆☆☆☆ Found in Text Mining only
Acromegaly	Acromegaly	CTD_human_DG	1682667, 18381583, 18388193, 9186818		★☆☆☆☆ Found in Text Mining only
Acromegaly	Acromegaly	LHGDN	18037753		★☆☆☆☆ Found in Text Mining only
Acromegaly	Acromegaly	Pubtator	26949262	Inhibit	★☆☆☆☆ Found in Text Mining only
ACROMESOMELIC DYSPLASIA, MAROTEAUX TYPE	Acromesomelic dysplasia	BEFREE	16384845		★☆☆☆☆ Found in Text Mining only
Acute Cerebrovascular Accidents	Stroke	BEFREE	27377914		★☆☆☆☆ Found in Text Mining only
Acute Confusional Senile Dementia	Senile Dementia	CTD_human_DG	15750215		★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	LHGDN	18377765		★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	21708381		★☆☆☆☆ Found in Text Mining only
Acute Kidney Insufficiency	Acute Kidney Insufficiency	CTD_human_DG	7540432		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	14707713, 26159252		★☆☆☆☆ Found in Text Mining only
Acute myelomonocytic leukemia	Myelomonocytic Leukemia	BEFREE	9766653		★☆☆☆☆ Found in Text Mining only
Acute Undifferentiated Leukemia	Leukemia	BEFREE	30269902		★☆☆☆☆ Found in Text Mining only
Adamantinous Craniopharyngioma	Adamantinous Craniopharyngioma	BEFREE	31666193		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	12767906, 15514114, 17399767, 18026134, 20104520, 21728395, 22146489, 22342683, 24485233, 25944691, 26026165, 27088794, 7546777		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	19050262		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	16343104		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	18006928, 22146489, 22241325		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	24751329, 27644646		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	16619240, 21683689, 23817810, 23990442, 25344917, 29255466, 30190423		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	15208677, 28499807, 31851103		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	31312023		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	10498342, 10937058, 11972303, 12807513, 15677710, 18611974, 20335450, 23648743, 24194259, 29728863, 29910227, 29975581, 30141524, 30880207, 8669808		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	CTD_human_DG	1611713		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	24194259, 29593647		★☆☆☆☆ Found in Text Mining only
Adenoma, Basal Cell	Adenoma	CTD_human_DG	1611713		★☆☆☆☆ Found in Text Mining only
Adenoma, Microcystic	Adenoma	CTD_human_DG	1611713		★☆☆☆☆ Found in Text Mining only
Adenoma, Monomorphic	Adenoma	CTD_human_DG	1611713		★☆☆☆☆ Found in Text Mining only
Adenoma, Trabecular	Adenoma	CTD_human_DG	1611713		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyps	Adenomatous Polyposis	BEFREE	21728395, 23801064		★☆☆☆☆ Found in Text Mining only
Adrenal cortical hypofunction	Adrenal Cortical Hypofunction	BEFREE	22269647		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Neoplasms	Adrenal neoplasia	BEFREE	16595699		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	30213025, 31185266		★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	BEFREE	10425444, 18611974, 18854392, 22170383, 26994514, 30069455, 30838516, 8669808		★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	1702931	Associate	★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	19670442, 31194684		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	28153033		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	31633515		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	11911248, 15195141, 20692232, 27255663		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	12714661, 28238097, 30594908		★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	18854392, 28230926, 29963827, 30069455, 30838516, 31034883		★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	BEFREE	17569567, 24464444		★☆☆☆☆ Found in Text Mining only
Alopecia, Male Pattern	Alopecia, Male Pattern	BEFREE	12894070, 30096107		★☆☆☆☆ Found in Text Mining only
Alveolitis, Fibrosing	Alveolitis	CTD_human_DG	15286697		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	19531281, 22476197, 26059363, 26297026, 30056117, 33649380, 35571248, 36035305, 36710671	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	32651323	Inhibit	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Early Onset	Alzheimer disease	CTD_human_DG	15750215		★☆☆☆☆ Found in Text Mining only
Alzheimer disease, familial, type 3	Alzheimer disease	BEFREE	30903695		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	CTD_human_DG	15750215		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	18198415, 23089282, 24054991		★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	CTD_human_DG	15750215		★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease, Focal Onset	Alzheimer disease	CTD_human_DG	15750215		★☆☆☆☆ Found in Text Mining only
Amnesia	Amnesia	BEFREE	31760608		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	22230888, 23401344, 29572520, 30981749		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	10896693, 22246875	Associate	★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	11732278, 15657392, 15852403, 17531227, 17597610, 19038252, 19572220, 21259326, 22621959, 27142684, 27617773, 29149058, 29294332, 29447858, 29499331, 30414993, 30903695		★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	27992374		★☆☆☆☆ Found in Text Mining only
Anaplastic astrocytoma	Anaplastic Astrocytoma	BEFREE	11304771		★☆☆☆☆ Found in Text Mining only
Androgen Receptor Deficiency	Androgen-Insensitivity Syndrome	BEFREE	23859805		★☆☆☆☆ Found in Text Mining only
Androgen-Insensitivity Syndrome	Androgen-Insensitivity Syndrome	BEFREE	21308753, 23364988, 23859805, 27554350		★☆☆☆☆ Found in Text Mining only
Androgenetic Alopecia	Androgenetic Alopecia	BEFREE	12894070, 30096107		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	16005636, 28415730, 30761980		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	Pubtator	28415730	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Aplastic	Aplastic anemia	Pubtator	39596362	Associate	★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	11563770, 31209247		★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	LHGDN	17396438		★☆☆☆☆ Found in Text Mining only
Angiomyolipoma of kidney	Angiomyolipoma Of Kidney	BEFREE	17592551		★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	25295265		★☆☆☆☆ Found in Text Mining only
Anodontia	Anodontia	Pubtator	25384883	Associate	★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	23980075, 24745611, 28499807, 29901181, 29912760, 31851103		★☆☆☆☆ Found in Text Mining only
Anophthalmos	Syndromic microphthalmia	BEFREE	18628516		★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia	BEFREE	17389700, 29179911, 31656971		★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid Syndrome	LHGDN	12861174		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety disorder	Pubtator	24623853, 31787098	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	24958891, 29031771, 29865234, 30068974, 31607475		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	24958891, 29031771, 29865234, 30068974, 31607475		★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic valve disease	Pubtator	10400911	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	16639715, 26943587, 30883989		★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic valve stenosis	Pubtator	10400911	Stimulate	★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic Valve Sclerosis	BEFREE	29137319, 9264495		★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	18854392, 28230926, 29963827, 30069455, 30838516, 31034883		★☆☆☆☆ Found in Text Mining only
AROMATASE EXCESS SYNDROME	Aromatase Excess Syndrome	BEFREE	16824679		★☆☆☆☆ Found in Text Mining only
Arrhythmias Cardiac	Cardiac arrhythmias	Pubtator	32755466	Associate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	12791939, 16179273, 16361587, 17916769, 18477064, 19626396, 20671230, 20872173, 21281823, 21664162, 21708381, 21872589, 24401213, 27905925, 28287842, 28596451, 28611056, 28724798, 28850155, 29201918, 29248598, 29424780, 29463262, 29707570, 30354209, 30735831, 31068820, 31518159, 8922883		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	Pubtator	20872173	Associate	★☆☆☆☆ Found in Text Mining only
Arthralgia	Arthralgia	Pubtator	33168080	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	23232804, 27695067, 28583713, 28614768		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	33168080	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	27041823, 27141097, 32682111, 33168080, 38270302	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	18714538	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	BEFREE	30146725, 30535455, 31322198		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Astrocytoma	Astrocytoma	BEFREE	11550306, 1370435, 19472104, 8494908		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	11550306	Associate	★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	11172010, 26587829	Associate	★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	19898915		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	11348998, 11849456, 16361587, 32065979	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	12791939, 16179273, 16361587, 17916769, 18477064, 20671230, 21281823, 21664162, 21708381, 21872589, 24401213, 27905925, 28287842, 28596451, 28611056, 28724798, 28850155, 29144802, 29201918, 29248598, 29424780, 29463262, 29707570, 30354209, 30735831, 31068820, 31518159, 8922883		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	LHGDN	12791939, 15625284		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	38157252	Inhibit	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	28596451, 29723239, 30770724, 30910708, 31625260		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	32548700	Associate	★☆☆☆☆ Found in Text Mining only
Atrophy	Atrophy	Pubtator	15100091	Inhibit	★☆☆☆☆ Found in Text Mining only
Atrophy of testis	Testicular atrophy	BEFREE	12603011		★☆☆☆☆ Found in Text Mining only
Attention Deficit and Disruptive Behavior Disorders	Attention deficit hyperactivity disorder	Pubtator	25674216	Associate	★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	HPO_DG			★☆☆☆☆ Found in Text Mining only
Atypical Ductal Breast Hyperplasia	Breast Hyperplasia	BEFREE	21217522		★☆☆☆☆ Found in Text Mining only
Atypical Teratoid Rhabdoid Tumor	Teratoid Rhabdoid Tumor	BEFREE	23624780		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	27378147, 31530830, 32129578, 32591005, 35395866, 36862688	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	32193494	Stimulate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	27378147, 28110691, 28551754		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	11570630	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	CTD_human_DG	17547689		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	BEFREE	30593420, 31383342		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	Pubtator	32591005, 33564861	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune Diseases	BEFREE	24785566, 28702323		★☆☆☆☆ Found in Text Mining only
Autoimmune thyroiditis	Autoimmune Thyroiditis	BEFREE	31579073		★☆☆☆☆ Found in Text Mining only
Autonomic nervous system disorders	Autonomic Central Nervous System Diseases	BEFREE	30524358		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	25885794, 29363719, 31794485		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	18006928, 20403354		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	34684639	Associate	★☆☆☆☆ Found in Text Mining only
Beckwith-Wiedemann Syndrome	Beckwith-Wiedemann Syndrome	BEFREE	14707713, 30069455, 8838774		★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	22199345, 28808855, 30069455		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	15586244, 17702894, 21181231, 21536469, 23720424, 26400665, 26954072, 29129118, 29460133, 30883989, 7521342, 7525636, 9215294		★☆☆☆☆ Found in Text Mining only
beta Thalassemia	beta Thalassemia	LHGDN	17709895		★☆☆☆☆ Found in Text Mining only
Bile duct carcinoma	Bile duct carcinoma	BEFREE	18234643		★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary Atresia	BEFREE	9398004		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	21302346, 25740013, 28135645, 30336492		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	21302346, 23619527		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	23619527	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	33274367	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bladder Neoplasm	Bladder Neoplasm	BEFREE	11453542, 11749868, 19415693, 20395438, 22859931, 24999188, 28123579, 28882129, 29393438, 29848696, 29971779, 31076571, 8618347		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	CTD_human_DG	19415693		★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	16953217, 18246120, 19508387		★☆☆☆☆ Found in Text Mining only
Blepharoptosis	Ptosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	11122154, 12915683, 28529639	Associate	★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	15256976		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	22357739	Inhibit	★☆☆☆☆ Found in Text Mining only
Bone Diseases Metabolic	Bone disease	Pubtator	27744012, 35575247	Associate	★☆☆☆☆ Found in Text Mining only
Bone Diseases, Developmental	Bone Disease	BEFREE	30273601		★☆☆☆☆ Found in Text Mining only
Bone Neoplasms	Bone neoplasm	Pubtator	29232358	Associate	★☆☆☆☆ Found in Text Mining only
Brain Injuries	Brain injuries	Pubtator	31787098	Associate	★☆☆☆☆ Found in Text Mining only
Brain Injuries Traumatic	Brain injuries	Pubtator	31787098	Associate	★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	BEFREE	18841090, 20494600, 29749511		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Neoplasms	Brain Neoplasms	BEFREE	18562769, 31480400		★☆☆☆☆ Found in Text Mining only
Breast adenocarcinoma	Breast Adenocarcinoma	BEFREE	21719561		★☆☆☆☆ Found in Text Mining only
Breast Cancer, Familial	Breast Cancer	BEFREE	15756256, 17010055, 19075671		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10070856, 10099938, 10364250, 10642432, 10650934, 10766344, 10995036, 11245436, 11250706, 11479214, 11747348, 11768601, 11948015, 11955796, 12082019, 12115549, 12115579, 12389335, 12554767, 12574821, 12610514, 12890810, 12970748, 1421420, 1421422, 1421423, 14520693, 15308584, 15386404, 15538047, 15585484, 15598771, 15668470, 15756256, 15756268, 15818613, 15922332, 15986122, 16214911, 16215864, 16284391, 16284492, 16306136, 16322331, 16332723, 16404426, 16475694, 1649393, 16533767, 16537700, 16752221, 16795042, 17010055, 17043687, 17047053, 17051426, 17063263, 17082888, 17133354, 17170218, 17311016, 17458902, 17484040, 17561390, 17595785, 17651480, 17909257, 17972510, 18045956, 18064566, 18444168, 18481170, 18596909, 18757322, 18785005, 18819936, 18827819, 18991569, 19002570, 19229608, 19261680, 19418218, 19536088, 19543094, 19551864, 19597750, 19622619, 19786462, 19846909, 19865540, 20080972, 20089431, 20155489, 20204283, 20206441, 20634197, 20705284, 20810604, 2082190, 20825649, 21113804, 21168492, 21177763, 21217522, 21273576, 21292829, 21390492, 21455574, 21455766, 21477610, 21480260, 21484083, 21525039, 2152773, 21541704, 21562710, 21567071, 21574055, 21595894, 21719561, 21723890, 2174437, 21854628, 21882221, 21888628, 21904903, 21908557, 22014575, 22182837, 22217202, 22235273, 22297468, 22442272, 22551578, 22564703, 22739988, 22801219, 22895778, 22906881, 23075937, 23180020, 23250396, 23348700, 23549953, 23628798, 23686499, 23782942, 24039934, 24227890, 24310658, 24392142, 24503796, 2463838, 24686172, 25085903, 25241146, 25680198, 25743390, 25956506, 26100469, 26191333, 26276395, 26400847, 26621843, 26655502, 26898459, 26902691, 26936396, 27063095, 27213582, 27341075, 27353258, 2747657, 27742668, 28096479, 28223691, 28236033, 28296140, 28315227, 28369883, 28478612, 28551627, 28579830, 28617135, 28628857, 28656281, 28947975, 29074537, 29162853, 29180608, 29253837, 29486622, 29535813, 29910690, 30203578, 30229539, 30286782, 30293548, 30317122, 30320391, 30388235, 3041262, 30458886, 31317318, 31337427, 31490549, 3167228, 31771180, 3312244, 3731113, 7521344, 7757999, 8125161, 8595162, 8665514, 9010238, 9014838, 9527274, 9615787, 9735418		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	17520698, 18398872		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Diseases	Breast disease	Pubtator	25542925	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	10196234, 10424760, 10967123, 11815987, 11940579, 12364325, 12610514, 12783932, 12867429, 12890810, 15509657, 15756256, 15922332, 16475694, 16936263, 16940181, 16965238, 17166846, 17311016, 17317669, 17591841, 17922461, 18403642, 18757322, 19047149, 19349962, 19569175, 19786462, 19865540, 20051100, 20051101, 20089431, 20302654, 20634197, 20643779, 20974640, 21112394, 21315112, 21410323, 21455574, 21525039, 21541704, 21719561, 21882221, 22429491, 22739988, 22799344, 23180020, 23226206, 23782942, 24380854, 24686172, 25167778, 25285521, 25385317, 25385439, 25542925, 25556435, 25774687, 25824321, 26100469, 26281834, 26607846, 26655502, 26738606, 27364358, 27631779, 28030849, 28369883, 28478612, 28544544, 29029116, 29074537, 29114882, 29162853, 29212519, 30229539, 30293548, 30692633, 31771180, 32435229, 32444795, 32736587, 34191793, 34583967, 35115550, 35396499, 35403707, 36193308, 36450530, 36882618, 37081542, 37108716, 39451175, 7593132, 7710954, 8347483, 8581274, 8595162, 9388270, 9545345, 9649125	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	16404426, 16537700, 2174437, 25956506, 32169310, 34362338	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	38189813	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brittle diabetes	Brittle diabetes mellitus	CTD_human_DG	24632065		★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	18614962, 26719145		★☆☆☆☆ Found in Text Mining only
Brooke-Spiegler syndrome	Brooke-Spiegler Syndrome	BEFREE	9202662		★☆☆☆☆ Found in Text Mining only
Bulbo-Spinal Atrophy, X-Linked	Bulbospinal Atrophy, X-Linked	BEFREE	19679072, 28511915, 30337273		★☆☆☆☆ Found in Text Mining only
Bulimia Nervosa	Bulimia	BEFREE	29179911		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	23047741	Associate	★☆☆☆☆ Found in Text Mining only
Cancer of Nasopharynx	Nasopharyngeal Cancer	BEFREE	17908353		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	11278392, 11404775, 11550306, 15929170, 18308828, 18596909, 19491931, 21103921, 23801064, 24294361, 24586243, 25385439, 26068646, 26738606, 29029116, 29232358, 30333226, 30786680, 32314747, 32717139, 32851683, 33888009, 34836359, 36973940, 7593132	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	23226206	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	10937058, 12086849, 12188907, 14528284, 15514114, 21154998, 21854509, 23056402, 24026884, 28348577, 29848696, 31158304, 7627387, 8214294, 8669808		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	16015705, 17030190, 21569410, 22799302, 24511663, 25052889, 26138883, 28051262, 28713927, 29981339, 30092792, 30341252, 33336732, 33960267, 35196258, 35297369, 36374927	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	24586785	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	25053419	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma in Situ	Carcinoma in situ	Pubtator	9536279	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	11453542, 11749868, 19415693, 20395438, 22859931, 24999188, 28123579, 28882129, 29393438, 29848696, 29971779, 31076571		★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	17382509		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	10793110, 10974650, 12489029, 14559833, 15374981, 15514114, 16741161, 17134788, 17196841, 17277889, 17588222, 18450319, 20051100, 20051101, 21447628, 21478904, 21683689, 22347413, 23185474, 23454899, 23980150, 24008975, 24310658, 24615087, 25173427, 26342551, 26430715, 27344406, 27384677, 28330997, 28362176, 29017078, 29066738, 29712908, 30018981, 30158168, 30604632, 31083179, 31559898		★☆☆☆☆ Found in Text Mining only
Carcinoma of Male Breast	Breast Carcinoma, male	BEFREE	23308200		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	24237932, 29603059	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	37533202	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	10748176, 15086466, 26587829, 27279483, 27976731, 28453463	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	30594912, 33888009	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	15262997, 17341442, 17914107, 18236213, 19699512, 19858071, 21726895, 22072919, 22700681, 24237932, 28898232, 29251331, 29603059, 29922232, 31728045		★☆☆☆☆ Found in Text Mining only
Carcinoma, Spindle-Cell	Carcinoma	BEFREE	23266446		★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinosarcoma	BEFREE	10779632		★☆☆☆☆ Found in Text Mining only
Cardiomegaly	Cardiomegaly	Pubtator	10400911	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathies	Cardiomyopathy	BEFREE	15611844, 22563064, 28796250, 31079698, 31753790		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	24249720	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	37372424	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic	Hypertrophic cardiomyopathy	Pubtator	11782760, 35970858	Stimulate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic	Hypertrophic cardiomyopathy	Pubtator	24396035	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Restrictive	Restrictive cardiomyopathy	Pubtator	36973824	Stimulate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	19332270, 22563064, 29217479		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	22563064, 29217479, 29941485		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	10446938, 11246885, 14671411, 15466497, 15761241, 17377412, 18544576, 19223521, 20215395, 21039458, 21664162, 22479346, 24217936, 28164755, 28179448, 28611056, 28646237, 29208737, 29248598, 29474865, 29596445, 29936324, 30735831, 30910708, 31327319, 31396153, 31705797, 31808500		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	11246885, 16361587, 21039458, 21664162, 22479346, 24178975, 32548700, 32678007, 35285386, 36739654, 37881939, 39354608	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	LHGDN	16645019, 18603571		★☆☆☆☆ Found in Text Mining only
Carney Complex	Carney Complex	BEFREE	27535175		★☆☆☆☆ Found in Text Mining only
Carney Complex	Carney complex	Pubtator	27535175	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	LHGDN	15087580		★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	BEFREE	16942485		★☆☆☆☆ Found in Text Mining only
Carpal Tunnel Syndrome	Carpal Tunnel Syndrome	BEFREE	28301320		★☆☆☆☆ Found in Text Mining only
Carpal Tunnel Syndrome	Carpal tunnel syndrome	Pubtator	34746972	Associate	★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	1586240	Stimulate	★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	15882567, 16603065, 22160392	Associate	★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	23734076, 30581325		★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	Pubtator	34746972	Associate	★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	12373017		★☆☆☆☆ Found in Text Mining only
Central Precocious Puberty	Central Precocious Puberty	CTD_human_DG	21402727		★☆☆☆☆ Found in Text Mining only
Cerebral Hemorrhage	Cerebral hemorrhage	Pubtator	16361587, 36169245	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Hypoxia-Ischemia	Cerebral Hypoxia-Ischemia	BEFREE	20494600		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	16361587, 23121326, 32548700	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	19513085, 23121326, 29257289		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	32065979	Stimulate	★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	LHGDN	17912004		★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	BEFREE	28236062, 29780293		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	11735233, 15567334, 16361587, 19513085, 21259326, 24005314, 24708646, 26556536, 26762506, 27377914, 28317235, 28325900, 28596451, 28724170, 28817801, 28833493, 29898838, 30443183, 30620251, 31019991, 31327319, 31846748		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	LHGDN	11953210, 12508918		★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular Disorders	BEFREE	31692426		★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular disorder	Pubtator	37881939	Associate	★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	15262997, 16400188, 18199731, 25384883, 27206217, 30429055		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	15262997, 16400188, 18199731, 25384883, 27206217, 30429055		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	22878902, 26159252, 29656114		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	11911248, 15195141, 20692232, 27255663		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	16936263, 35113866	Associate	★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	18234643		★☆☆☆☆ Found in Text Mining only
Cholecystitis	Cholecystitis	Pubtator	40221697	Associate	★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	CTD_human_DG	12826230		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholestasis	Cholestasis	BEFREE	17210751		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chondrosarcoma	Chondrosarcoma	BEFREE	11889599, 21344385		★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	27418340, 32314747	Associate	★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	BEFREE	30821656		★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	17035059		★☆☆☆☆ Found in Text Mining only
Choroid Plexus Papilloma	Choroid Plexus Papilloma	BEFREE	30249230		★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	34220309	Stimulate	★☆☆☆☆ Found in Text Mining only
Chronic heart failure	Heart Failure	BEFREE	31359246		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	10620558, 22123209, 27653449, 29214734		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	10499309, 10620558, 29214734, 31352157, 9255221		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Insufficiency	Renal Insufficiency	BEFREE	10499309, 9255221		★☆☆☆☆ Found in Text Mining only
Chronic lung disease	Lung Diseases	BEFREE	29702590		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	15982345		★☆☆☆☆ Found in Text Mining only
Chronic metabolic acidosis	Metabolic Acidosis	BEFREE	10955915		★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	GENOMICS_ENGLAND_DG	8857020		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	28704095		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	30624092		★☆☆☆☆ Found in Text Mining only
Ciliopathies	Ciliopathies	BEFREE	25664603		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	11849991, 12044524, 12603011, 17024107, 27775431, 28125073, 28472963, 28678199, 29113370		★☆☆☆☆ Found in Text Mining only
Class III malocclusion	Malocclusion	BEFREE	20477965, 24386886		★☆☆☆☆ Found in Text Mining only
Classical galactosemia	Galactosemia	BEFREE	27225493		★☆☆☆☆ Found in Text Mining only
Clinically Isolated Syndrome, CNS Demyelinating	Demyelinating Diseases	CTD_human_DG	9452187		★☆☆☆☆ Found in Text Mining only
Clinodactyly	Clinodactyly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Clinodactyly of fingers	Clinodactyly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Clinodactyly of the 5th finger	Camptodactyly of fingers	HPO_DG			★☆☆☆☆ Found in Text Mining only
Clumsiness - motor delay	Motor delay	HPO_DG			★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	19563785		★☆☆☆☆ Found in Text Mining only
Cockayne Syndrome	Cockayne syndrome	Pubtator	26755826	Associate	★☆☆☆☆ Found in Text Mining only
Cockayne Syndrome, Type II	Cockayne Syndrome	BEFREE	23562425		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	17848918, 29406271		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	27115487	Inhibit	★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	34078313	Associate	★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	CTD_human_DG	24782617		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colitis	Colitis	BEFREE	28538694, 29907597		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colitis Ulcerative	Ulcerative colitis	Pubtator	35733095	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	11920634, 12374697, 12379772, 12485928, 14633695, 15247132, 15688407, 16053920, 16448675, 18064302, 19533369, 19608011, 20001499, 20504360, 21406062, 21638027, 21720213, 22159423, 22565227, 24182354, 25398592, 26503233, 26840943, 26850678, 2747657, 27737962, 29895971, 29907597, 30003309, 30257507, 30952709, 31341157, 3779638, 9731515, 9742949		★☆☆☆☆ Found in Text Mining only
Colonic Diseases	Colonic disease	Pubtator	15668488, 22159423	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	12412161, 36518255	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	17560457, 18054929		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	3779638		★☆☆☆☆ Found in Text Mining only
Colonic Polyps	Colonic polyps	Pubtator	20580999, 31341157	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	10985759, 11904318, 12820418, 14633695, 15247132, 15668488, 15894673, 15894694, 15941947, 16053920, 16418517, 17007015, 18031946, 18308828, 18623088, 18636198, 19784788, 20099280, 20473900, 20713879, 20935157, 21099348, 21161940, 21717907, 21728395, 21873172, 22710713, 23165777, 23180020, 23801064, 24175768, 24618737, 24751329, 25189651, 25557790, 25592039, 26381944, 26840943, 27644646, 27649841, 27681944, 27749737, 27918854, 28188432, 28435295, 28927068, 29023587, 29044573, 29290648, 29504525, 29886785, 30334445, 30361904, 30410539, 30572720, 30636592, 31018241, 31089868, 31305125, 31341157, 31480481, 31647596, 8910616		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	11035789, 12218293, 1558785, 15668488, 18308828, 19064544, 19491931, 19690970, 20459642, 20733350, 20935157, 21406062, 21791631, 21909943, 22112971, 22354904, 22363134, 22565227, 22710713, 23180020, 23337790, 23801064, 24175768, 26381944, 26989024, 27138191, 28369940, 28902367, 29023587, 29257307, 29504525, 29886785, 30361904, 31341157, 31882986, 31884074, 32173812, 32717139, 35484177, 36303457, 36896461, 8910616	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	11904318		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	12218293, 15849510, 18623088, 18636198		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	18842999, 20504360	Stimulate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms Hereditary Nonpolyposis	Lynch syndrome	Pubtator	19690970, 21407259	Associate	★☆☆☆☆ Found in Text Mining only
Combined Pituitary Hormone Deficiency	Combined pituitary hormone deficiency	Pubtator	28332357	Inhibit	★☆☆☆☆ Found in Text Mining only
Complete hydatidiform mole	Complete Hydatidiform Mole	BEFREE	30213486		★☆☆☆☆ Found in Text Mining only
Cone-Rod Dystrophy 2	Cone-rod dystrophy	BEFREE	30829545		★☆☆☆☆ Found in Text Mining only
Congenital atresia of extrahepatic bile duct	Extrahepatic Biliary Atresia	BEFREE	9398004		★☆☆☆☆ Found in Text Mining only
Congenital bilateral ptosis	Congenital bilateral ptosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital Camptodactyly	Congenital Camptodactyly	BEFREE	19579756		★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	26015398		★☆☆☆☆ Found in Text Mining only
Congenital Disorders of Glycosylation	Congenital disorder of glycosylation	BEFREE	27089502		★☆☆☆☆ Found in Text Mining only
Congenital Disorders of Glycosylation	Congenital disorder of glycosylation	Pubtator	35211808	Inhibit	★☆☆☆☆ Found in Text Mining only
Congenital Dysplasia Of The Hip	Developmental dysplasia of the hip	BEFREE	30915115		★☆☆☆☆ Found in Text Mining only
Congenital Heart Defects	Congenital heart defects	BEFREE	29426944		★☆☆☆☆ Found in Text Mining only
Congenital heart disease	Congenital Heart Disease	BEFREE	18401200		★☆☆☆☆ Found in Text Mining only
Congenital Hyperinsulinism	Hyperinsulinemic hypoglycemia	BEFREE	10487673		★☆☆☆☆ Found in Text Mining only
Congenital sensorineural hearing loss	Congenital Sensorineural Hearing Loss	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	12505877, 14597618, 15276114, 15611844, 16159864, 16406300, 19332270, 21664162, 22370764, 22825921, 23204842, 23423640, 27904993, 28695463, 29042931, 29137319, 29153202, 29180262, 29574782, 30078811, 30098987, 31079698, 31359246, 31753790		★☆☆☆☆ Found in Text Mining only
Contiguous gene syndrome	Contiguous gene syndrome	BEFREE	11434725		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	15661050, 15753986, 17443497, 21625219, 23548153, 27226530, 27976731, 28453463, 28484923, 29158991, 30271170, 30862574		★☆☆☆☆ Found in Text Mining only
Corneal Diseases	Corneal Diseases	CTD_human_DG	12824234		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Corneal Diseases	Corneal disease	Pubtator	30335528	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Aneurysm	Coronary aneurysm	Pubtator	21046444	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	15879687, 20872173, 21046444, 21664162, 21708381, 23423640, 25977383, 27835972, 28685580		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	15879687, 21046444, 21708381, 23423640, 25977383, 27835972, 28685580, 30497090		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	Pubtator	20872173, 21046444, 23423640, 31886261, 32548700, 40020258	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary heart disease	Coronary Heart Disease	BEFREE	15879687, 21708381, 23423640, 25977383, 28685580		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	LHGDN	15879687		★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	31442251		★☆☆☆☆ Found in Text Mining only
CRANIOSYNOSTOSIS, TYPE 2	Craniosynostosis	BEFREE	23562425		★☆☆☆☆ Found in Text Mining only
Critical Illness	Critical illness	Pubtator	26427594	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	11093955, 19751734	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn Disease	BEFREE	11292612, 12181198, 18704594, 19751734, 26428636, 29329430, 30483486		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn disease	Pubtator	11292612, 26428636	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn Disease	CTD_human_DG	19751734		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn`s disease of large bowel	Crohn`s Disease Of Large Bowel	CTD_human_DG	19751734		★☆☆☆☆ Found in Text Mining only
Crohn`s disease of the ileum	Crohn`s Disease Of The Ileum	CTD_human_DG	19751734		★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	Pubtator	29615365	Associate	★☆☆☆☆ Found in Text Mining only
Cushing Syndrome	Cushing`s Syndrome	BEFREE	27578200		★☆☆☆☆ Found in Text Mining only
Cushing Syndrome	Cushing syndrome	Pubtator	36316863	Associate	★☆☆☆☆ Found in Text Mining only
Cutaneous Fibrous Histiocytoma	Fibrous Histiocytoma	BEFREE	1311795		★☆☆☆☆ Found in Text Mining only
Cutaneous Mastocytosis	Cutaneous mastocytosis	BEFREE	28801055		★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	18237549, 28092675, 29137261		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	21059918, 21068693, 23698746, 28384265, 29098662, 31006073		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	31462537	Associate	★☆☆☆☆ Found in Text Mining only
Deficiency of testosterone biosynthesis	Deficiency Of Testosterone Biosynthesis	BEFREE	11344229		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	11083281, 14733605, 15082485, 16257278, 19036616, 19180501, 20633672, 20733349, 22178467, 22939867, 23232804, 23322062, 23546957, 25202993, 28898893, 29112682, 29131268, 29966748, 30140415, 30335903, 31638855, 31654748, 31765739, 7738951, 8609369, 8772582, 9562333, 9771213		★☆☆☆☆ Found in Text Mining only
Delirium	Delirium	BEFREE	17203511, 19269948, 25189345, 29605680, 30488836, 31770149		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Delirium	Delirium	PSYGENET_DG	17203511, 19269948, 25189345		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Delirium, Dementia, Amnestic, Cognitive Disorders	Delirium, Dementia, Amnestic, Cognitive Disorders	BEFREE	20818790		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	LHGDN	12508915		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	16983186, 20821386, 24820016, 28123476, 29065116, 29155799, 30809143		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	19531281, 34363732	Associate	★☆☆☆☆ Found in Text Mining only
Dementia, Vascular	Dementia	BEFREE	16983186, 28963885, 28992623		★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating diseases	Pubtator	29596844	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Demyelinating Diseases	Demyelinating Diseases	CTD_human_DG	9452187		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	BEFREE	19056428, 24878678, 25836355, 27527872, 28439104, 28594820, 28833493, 29031771, 29787856, 29865234, 30063009, 30278200, 8938649		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	PSYGENET_DG	21524689, 22189158, 24878678, 25151093, 25583186		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder	Major depressive disorder	Pubtator	26967642, 27527872, 31787098	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder Major	Major depressive disorder	Pubtator	32384884, 35498133	Associate	★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	30513923		★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Development Disorder	BEFREE	30018981		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	10987675, 11145579, 11147784, 12086966, 12890810, 14604996, 14716834, 15248828, 15761241, 16548790, 16642022, 17709881, 18270301, 19064563, 19258434, 19786971, 20215395, 20378848, 21690232, 21933315, 22370764, 22476197, 22682639, 22825921, 23374718, 24143239, 24217936, 24289561, 24313349, 24751329, 25287599, 26148588, 26712712, 27142684, 28123476, 28125073, 28164755, 28167325, 28225314, 28499807, 28500773, 28646158, 28702323, 28729536, 29040592, 29054976, 29201918, 29250665, 29384065, 29534073, 29618021, 29663652, 29989677, 30221656, 30254418, 30592792, 30898176, 31319676, 31361542, 31504635, 31562314, 31847392		★☆☆☆☆ Found in Text Mining only
Diabetes Complications	Diabetes complications	Pubtator	27349183	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	20144210	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	22893718, 26067361, 30859796	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	31424259	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Insipidus	Diabetes Insipidus	BEFREE	30694793		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	10987675, 11145579, 11147784, 11527091, 12086966, 12890810, 14604996, 14716834, 15240578, 15248828, 15750215, 15761241, 16189249, 16548790, 16642022, 17709881, 18270301, 18708105, 19064563, 19258434, 19680783, 19786971, 20215395, 20378848, 21690232, 21933315, 22370764, 22476197, 22681458, 22682639, 22825921, 23374718, 23828811, 24143239, 24217936, 24289561, 24313349, 24751329, 25287599, 25977383, 26148588, 26712712, 27142684, 27578200, 28068900, 28123476, 28125073, 28150161, 28164755, 28167325, 28225314, 28499807, 28500773, 28596451, 28646158, 28702323, 28729536, 28931726, 29040592, 29054976, 29113856, 29189984, 29201918, 29250665, 29384065, 29427460, 29534073, 29618021, 29663652, 29767287, 29989677, 30221656, 30254418, 30474822, 30592792, 30729134, 30898176, 31319676, 31336140, 31347550, 31361542, 31504635, 31562314, 31574933, 31847392		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	12631341, 16873705, 16962112, 19064563, 21099256, 22482470, 24143239, 24178975, 27125830, 29351335, 29440655, 32678007, 34363732, 34746972	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	24379526, 26976474, 27138191	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	12604504, 18317720, 36303457, 37170809, 37338602, 37468555, 8529513	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	24845759	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	11246885, 12890810, 16873705, 21099256, 25785549, 27218216, 27349183, 27863428, 28761040, 29440655, 31086127, 32548700, 33648986, 35094288, 35297369, 35656699, 8981937	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	24617714	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	37944849	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	10189536, 11175313, 11994404, 12373017, 15140033, 17218729, 18317720, 25547527, 26663878, 28283030, 28482269, 28961553, 29249623, 29663652, 29744370, 29989677, 30179684, 30900527, 31826866, 8177047, 9440474		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	CTD_human_DG	24632065		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Ketosis-Prone	Diabetes Mellitus	CTD_human_DG	24632065		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	10770205, 10987675, 11246885, 11485987, 11937187, 12086966, 12890810, 14671410, 15127203, 15761241, 15879687, 16189249, 16873705, 17062892, 17377412, 17537658, 18309377, 22548717, 22682639, 22992776, 23251408, 23351407, 24289561, 24751329, 25785549, 26148588, 26402757, 28088698, 28287842, 28315330, 28328831, 28867579, 28987875, 29250665, 29957017, 30030585, 30105830, 30105862, 30254418, 30289304, 30864372, 30898176, 31018241, 31319676, 31473834, 31669775, 31670029, 8104271		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	LHGDN	12086966		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Sudden-Onset	Diabetes Mellitus	CTD_human_DG	24632065		★☆☆☆☆ Found in Text Mining only
Diabetes, Autoimmune	Autoimmune Diabetes	BEFREE	23099863		★☆☆☆☆ Found in Text Mining only
Diabetes, Autoimmune	Autoimmune Diabetes	CTD_human_DG	24632065		★☆☆☆☆ Found in Text Mining only
Diabetic Angiopathies	Diabetic cardiomyopathy	LHGDN	12716855		★☆☆☆☆ Found in Text Mining only
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	CTD_human_DG	11375343		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	28990106, 37492198, 37656997	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	10426384, 27082896, 27218216, 29384065, 30254418, 31361542		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	LHGDN	14633859		★☆☆☆☆ Found in Text Mining only
Diabetic Neuropathies	Diabetic Nephropathy	BEFREE	27142684		★☆☆☆☆ Found in Text Mining only
Diabetic Polyneuropathies	Diabetic polyneuropathy	BEFREE	31670029		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	12813019, 15248828, 15277220, 16873705, 17851271, 27465937, 28167325, 29152139, 29663652, 31049357, 31473834		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Retinopathy	Diabetic Retinopathy	LHGDN	16873705, 17851271		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	16873705, 9924360	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Differentiated Thyroid Gland Carcinoma	Thyroid Carcinoma	BEFREE	22415807, 25019383, 31177118		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	28153033		★☆☆☆☆ Found in Text Mining only
Disorder of eye	Disorder Of Eye	BEFREE	21976954		★☆☆☆☆ Found in Text Mining only
Disorders of Sex Development	Disorders of sex development	Pubtator	22801570	Associate	★☆☆☆☆ Found in Text Mining only
Donohue Syndrome	Leprechaunism syndrome	BEFREE	18302477, 22768670, 23229189, 25153212, 2544784, 25465274, 6286709, 8881457		★☆☆☆☆ Found in Text Mining only
Donohue Syndrome	Donohue syndrome	Pubtator	18302477	Inhibit	★☆☆☆☆ Found in Text Mining only
dowling-degos disease	Dowling-Degos Disease	BEFREE	25365709		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	36577365	Associate	★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry Eye Syndromes	BEFREE	29452886		★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	BEFREE	10746655, 10770174, 11456284, 11836270, 12035938, 12217488, 12610293, 14614229, 14657428, 14714750, 15261845, 15266617, 15879683, 15928254, 16615302, 17148568, 17301034, 17462934, 17785692, 17785695, 18404972, 18556960, 18757483, 1879059, 19129715, 20050859, 20197676, 20374725, 20389102, 20463651, 20668042, 21237682, 21846964, 21968387, 22008389, 22071895, 22549341, 22832530, 23047741, 23182818, 23419423, 23596138, 23624134, 24243634, 24335034, 24356109, 25664603, 25835289, 26096762, 26437621, 26485222, 26883276, 26902202, 2707163, 27557428, 27688483, 28233247, 28743110, 28870985, 29025428, 29306561, 29397377, 29493124, 29653372, 29687007, 29724795, 29748515, 29789409, 29893990, 30197657, 30273774, 3031118, 30865930, 30988753, 31122262, 31152917, 31301056, 31444966, 31509834, 31539878, 31555216, 7328612, 8374676, 8770900, 8793418, 9255230, 9388817, 9401537, 9829213, 9855700		★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dwarfism Pituitary	Pituitary dwarfism	Pubtator	12604504, 27649665, 28332357, 3250861, 33762520, 36714562	Associate	★☆☆☆☆ Found in Text Mining only
Dwarfism Pituitary	Pituitary dwarfism	Pubtator	8514622	Stimulate	★☆☆☆☆ Found in Text Mining only
Dysautonomia	Dysautonomia	BEFREE	30524358		★☆☆☆☆ Found in Text Mining only
Dysautonomia Familial	Dysautonomia	Pubtator	22252855	Stimulate	★☆☆☆☆ Found in Text Mining only
Dysbiosis	Dysbiosis	Pubtator	39456258	Inhibit	★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	31086127, 39266979	Associate	★☆☆☆☆ Found in Text Mining only
Dysmorphic features	Dysmorphic Features	BEFREE	10777002, 12387515, 31604330		★☆☆☆☆ Found in Text Mining only
Eating Disorders	Eating Disorders	BEFREE	29179911		★☆☆☆☆ Found in Text Mining only
Empty Sella Syndrome	Empty Sella Syndrome	BEFREE	9826209		★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	Pubtator	23497056	Associate	★☆☆☆☆ Found in Text Mining only
End Stage Liver Disease	End Stage Liver Disease	BEFREE	8708531, 9398004		★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine system disease	Pubtator	29029116, 32529760	Associate	★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine System Diseases	BEFREE	29596445		★☆☆☆☆ Found in Text Mining only
Endometrial adenocarcinoma	Endometrial Adenocarcinoma	BEFREE	10585594, 17399767		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	10459850, 10779632, 10940495, 11955796, 15917160, 17598937, 18006148, 18852162, 21078522, 21145998, 21168492, 21442237, 22711307, 23402816, 25640355, 26193427, 26802879, 27121258, 29257334, 30137481, 30426831, 30628637, 31168597, 31320996, 7523316, 7527333, 7750475, 9935198		★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial Hyperplasia	BEFREE	17399767, 27121258		★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial hyperplasia	Pubtator	27121258	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	17399767, 20844834, 21078522, 21666489, 25640355, 27121258, 27409342, 27654259, 32641130, 33622671, 8314534, 9408887	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	LHGDN	18814240		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	31795319, 37737665	Inhibit	★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	BEFREE	17308170		★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	CTD_human_DG	21063030		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	11955796, 14644829, 17308170, 22259059, 26899323, 30838714, 31291762		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	LHGDN	12571183		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	Pubtator	15011750, 35072229, 35285386, 35303800, 38275748	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	CTD_human_DG	21063030		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	Pubtator	34930225	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	Pubtator	35459174	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Enterocolitis	Enterocolitis	BEFREE	12181198		★☆☆☆☆ Found in Text Mining only
Enthesitis	Enthesitis	BEFREE	27695067		★☆☆☆☆ Found in Text Mining only
Epilepsies Partial	Partial epilepsy	Pubtator	20416304	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	28078614, 30524358		★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	30524358		★☆☆☆☆ Found in Text Mining only
EPILEPTIC ENCEPHALOPATHY, EARLY INFANTILE, 2	Epileptic encephalopathy	BEFREE	29031192		★☆☆☆☆ Found in Text Mining only
Episodic Kinesigenic Dyskinesia 1	Episodic Kinesigenic Dyskinesia	BEFREE	23864113		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	17914107, 18236213, 19699512, 24237932, 28898232, 29251331, 29603059		★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	11694654, 22700994, 24885194, 27656832		★☆☆☆☆ Found in Text Mining only
Erectile dysfunction	Erectile Dysfunction	BEFREE	22133301, 23174226, 29603682, 30063074		★☆☆☆☆ Found in Text Mining only
Erythroid hyperplasia	Erythroid hyperplasia	BEFREE	29222208		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	2004373, 20104520, 21082354, 22146489, 24599933, 24615087, 25358597, 26662570, 28596684, 31115568		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	LHGDN	15517912		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	15517912, 24608110, 26662570	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	20104520, 21082354, 22146489, 24599933, 24615087, 28596684		★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	19759555		★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	14710346, 19533369, 21717907, 23085431, 23188799, 25603314, 27259270, 27286459, 2747657, 28652778, 29731738		★☆☆☆☆ Found in Text Mining only
Ewings sarcoma-primitive neuroectodermal tumor (PNET)	Ewing sarcoma	BEFREE	8054516		★☆☆☆☆ Found in Text Mining only
Exfoliation Syndrome	Exfoliation Syndrome	BEFREE	27245680, 31634339		★☆☆☆☆ Found in Text Mining only
Exophthalmos	Proptosis	BEFREE	31313753		★☆☆☆☆ Found in Text Mining only
Exudative age-related macular degeneration	Exudative Macular Degeneration	BEFREE	12714661, 23478260, 30594908		★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	CTD_human_DG	15750215		★☆☆☆☆ Found in Text Mining only
Familial Glucocorticoid Deficiency Type 1	Glucocorticoid Deficiency	BEFREE	11012566		★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	20403354, 24608110		★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	28502327, 29068127		★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi anemia	Pubtator	28502327	Associate	★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	28502327, 29068127		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	23351407, 29724029, 30130150		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	26741958	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	33125080	Inhibit	★☆☆☆☆ Found in Text Mining only
Fatty Liver Alcoholic	Fatty liver, alcoholic	Pubtator	30206761	Inhibit	★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	28125073, 30206761, 31243652		★☆☆☆☆ Found in Text Mining only
Female Urogenital Diseases	Female Urogenital Diseases	CTD_human_DG	16002989		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fibroid Tumor	Leiomyoma	BEFREE	11006320, 12413982, 15922007, 19012097, 19499404, 1979007, 2208134, 26546520, 26884457, 28875276, 3409868, 7573249, 7684390, 9184179		★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	LHGDN	15033949, 19012097		★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	28962916		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	17024107, 17410466, 30063751, 30105830, 30592792, 31171766, 31690932, 8708531		★☆☆☆☆ Found in Text Mining only
Folic Acid Deficiency	Folic Acid Deficiency	LHGDN	16111879		★☆☆☆☆ Found in Text Mining only
Follicular adenoma	Adenoma	CTD_human_DG	1611713		★☆☆☆☆ Found in Text Mining only
Follicular adenoma	Adenoma	BEFREE	23288662		★☆☆☆☆ Found in Text Mining only
Fragile X Syndrome	Fragile X Syndrome	BEFREE	27643697		★☆☆☆☆ Found in Text Mining only
Freeman-Sheldon syndrome	Freeman-Sheldon Syndrome	BEFREE	12035938		★☆☆☆☆ Found in Text Mining only
FRIEDREICH ATAXIA 1	Friedreich Ataxia	BEFREE	28286293, 29068127		★☆☆☆☆ Found in Text Mining only
Frontotemporal dementia	Frontotemporal dementia	BEFREE	30903695		★☆☆☆☆ Found in Text Mining only
Galactosemias	Galactosemia	BEFREE	27225493		★☆☆☆☆ Found in Text Mining only
Galactosemias	Galactosemia	Pubtator	32356415	Associate	★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	16443739	Associate	★☆☆☆☆ Found in Text Mining only
Gangrene	Gangrene	BEFREE	30470845		★☆☆☆☆ Found in Text Mining only
Gastric ulcer	Gastric ulcer	BEFREE	11208487		★☆☆☆☆ Found in Text Mining only
Gastrinoma	Gastrinoma	BEFREE	15867218		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	24608110	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	18372285, 18818517, 23252569, 24116170, 24133624, 25987131, 29206199, 31166382		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	18372285, 18419060, 24133624, 25987131	Associate	★☆☆☆☆ Found in Text Mining only
Giant Cell Tumor of Bone	Giant cell tumor of bone	BEFREE	29651441		★☆☆☆☆ Found in Text Mining only
Giant Cell Tumor of Bone	Giant cell tumor of bone	Pubtator	29651441	Associate	★☆☆☆☆ Found in Text Mining only
Gingival Diseases	Gingival diseases	Pubtator	33934404	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	19401404, 33746571	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	25923430, 27245680		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	10691731, 11550306, 12545204, 20820871, 22446686, 23526983, 24378652, 28389653, 30200644, 30231881, 8138595, 8174129, 9454896, 9576258		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	11477137, 11550306, 18507054, 19189657, 23526983, 28389653, 31805126, 36479381	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	LHGDN	17320297		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	24878820, 33025417	Stimulate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	10691731, 12545204, 19189657, 20820871, 21756999, 22446686, 23526983, 24378652, 26510428, 30116397, 30200644, 31805126, 8138595, 8174129, 9576258		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	BEFREE	10686404, 11472074, 18562769, 19235591, 21756999, 24378652, 26656446, 27893811, 28277190, 28944896, 30231881, 31305291, 31665421, 31805126, 3211366, 8138595, 9099954		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	Pubtator	11477137, 18562769, 27893811, 28277190, 28389653, 31805126	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	LHGDN	19235591		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	Pubtator	22168049	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	Pubtator	27560636	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Global developmental delay	Developmental Delay	BEFREE	18553546, 23486542		★☆☆☆☆ Found in Text Mining only
Globoid cell leukodystrophy	Globoid Cell Leukodystrophy	BEFREE	31036560		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	1283288		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	29402846, 32791747, 36978098	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	10567913	Inhibit	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	22429491	Associate	★☆☆☆☆ Found in Text Mining only
Glucocorticoid Receptor Deficiency	Glucocorticoid Receptor Deficiency	BEFREE	20555348		★☆☆☆☆ Found in Text Mining only
Glucose Metabolism Disorders	Glucose Metabolism Disorders	BEFREE	29642245		★☆☆☆☆ Found in Text Mining only
Glycogen storage disease type II	Glycogen Storage Disease	BEFREE	12714661, 30594908		★☆☆☆☆ Found in Text Mining only
Glycosuria, Renal	Glycosuria, Renal	BEFREE	11097625		★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	25716730, 26510816	Associate	★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	12794168, 16410300, 18768899, 28222462, 30385883, 30882687, 31399042, 9857239		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	18832736, 22506015, 26188228	Associate	★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	18797655, 22554965, 25485727, 26213859, 36521376	Associate	★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	33886620	Stimulate	★☆☆☆☆ Found in Text Mining only
Growth delay due to insulin-like growth factor type 1 deficiency	Growth Delay Due To Insulin-Like Growth Factor Deficiency	Orphanet			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Growth Disorders	Growth disorder	Pubtator	10890200, 11172010, 14657428, 1707060, 19189700, 20013551, 21177759, 23047741, 24243634, 25742519, 26902202, 28395282, 28768959, 29687007, 31835104, 31865343, 33524399, 36292632, 36577365, 36847142	Associate	★☆☆☆☆ Found in Text Mining only
Growth Disorders	Growth disorder	Pubtator	16820702, 28415932	Inhibit	★☆☆☆☆ Found in Text Mining only
Growth Hormone-Secreting Pituitary Adenoma	Somatotroph Adenoma	BEFREE	12919156, 27455094, 29290044, 30361628, 30643415, 31188431, 31781204		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	31579073		★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	17634559, 23482325, 24608110, 25355701, 28613101		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head And Neck Neoplasms	LHGDN	17113753		★☆☆☆☆ Found in Text Mining only
Hearing Loss Sensorineural	Hearing loss	Pubtator	36349665	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	17010800	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	18290876, 27623843, 29098623		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	LHGDN	18401200		★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	11923043, 23204842	Inhibit	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	12505877, 14597618, 15276114, 15611844, 16159864, 16406300, 19332270, 21664162, 22370764, 22825921, 23204842, 27904993, 29042931, 29137319, 29180262, 29574782, 30078811, 30098987, 31079698, 31753790		★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	17010800	Stimulate	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	21546606, 21664162, 23423640, 25591711, 32548700, 34989084	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure, Right-Sided	Heart Failure	BEFREE	27013635		★☆☆☆☆ Found in Text Mining only
Hemangioma	Hemangioma	BEFREE	30146616, 30720075		★☆☆☆☆ Found in Text Mining only
hemangiopericytoma	Hemangiopericytoma	BEFREE	10468998, 9692837		★☆☆☆☆ Found in Text Mining only
Hemianopsia	Hemianopsia	BEFREE	21744088		★☆☆☆☆ Found in Text Mining only
Hemimegalencephaly	Hemimegalencephaly	Pubtator	16196383	Associate	★☆☆☆☆ Found in Text Mining only
Hemoglobinuria Paroxysmal	Hemoglobinuria paroxysmal	Pubtator	28630090	Associate	★☆☆☆☆ Found in Text Mining only
Hemorrhagic Stroke	Hemorrhagic stroke	Pubtator	32065979	Associate	★☆☆☆☆ Found in Text Mining only
Hepatic Veno-Occlusive Disease	Hepatic veno-occlusive disease-immunodeficiency syndrome	BEFREE	28436969		★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	26919045	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	25852271	Associate	★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	10789725, 21369802		★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	Pubtator	10789725	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	19491931, 19551864, 30394935, 33272980	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary gingival fibromatosis	Hereditary Gingival Fibromatosis	BEFREE	27423905		★☆☆☆☆ Found in Text Mining only
Hereditary hemorrhagic telangiectasia	Hereditary Hemorrhagic Telangiectasia	BEFREE	30512964		★☆☆☆☆ Found in Text Mining only
Hereditary Malignant Neoplasm	Hereditary cancer	BEFREE	23182194		★☆☆☆☆ Found in Text Mining only
Hereditary Nonpolyposis Colorectal Cancer	Colorectal Cancer	BEFREE	16418517, 18623088		★☆☆☆☆ Found in Text Mining only
HETEROTAXY, VISCERAL, 2, AUTOSOMAL	Heterotaxy, Visceral	BEFREE	30018333		★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung Disease	BEFREE	29792527		★☆☆☆☆ Found in Text Mining only
Histiocytoma	Histiocytoma	BEFREE	1311795		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	15483786, 31633515		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	24489919	Associate	★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	12062094, 14725621, 15483786, 15845076, 17653274, 24347322, 24992836, 26876526, 31797328, 31834602		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Huntington Disease	Huntington disease	Pubtator	12062094	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Huntington Disease	Huntington disease	Pubtator	17653274	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hurthle Cell Tumor	Tumor	BEFREE	15661050		★☆☆☆☆ Found in Text Mining only
Hydatidiform Mole	Hydatidiform Mole	BEFREE	9721784		★☆☆☆☆ Found in Text Mining only
HYDATIDIFORM MOLE, RECURRENT, 1	Hydatidiform Mole	BEFREE	9721784		★☆☆☆☆ Found in Text Mining only
Hydrocephalus	Hydrocephalus	BEFREE	18553546		★☆☆☆☆ Found in Text Mining only
Hyperandrogenism	Hyperandrogenism	LHGDN	12240900		★☆☆☆☆ Found in Text Mining only
Hyperandrogenism	Hyperandrogenism	BEFREE	17442315		★☆☆☆☆ Found in Text Mining only
Hyperandrogenism	Hyperandrogenism	Pubtator	18840925	Associate	★☆☆☆☆ Found in Text Mining only
Hyperbilirubinemia, Neonatal	Hyperbilirubinemia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypercalciuria Absorptive 2	Hypercalciuria	Pubtator	27161247	Associate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	14978159, 16962112, 18270301, 19383984, 21968387, 23612968, 27966079, 28815409, 29345287, 7714106, 8530617		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	20185807, 31086127	Associate	★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	10099938, 12708611, 1281841, 15536017, 17202144, 17785698, 18303074, 18785179, 19116878, 23488611, 28088698, 28316059, 28475811, 28694663, 28987875, 29252200, 29989677, 30316800, 31243652, 31724103, 7714106, 9421379		★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	Pubtator	20185807	Associate	★☆☆☆☆ Found in Text Mining only
Hyperkinesis	Hyperkinesia	Pubtator	35395866	Stimulate	★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	28156155		★☆☆☆☆ Found in Text Mining only
Hyperostosis	Hyperostosis	BEFREE	29729471		★☆☆☆☆ Found in Text Mining only
Hyperostosis Frontalis Interna	Hyperostosis Of Skull	BEFREE	27901271		★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism, Primary	Hyperparathyroidism	BEFREE	9024241		★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism, Secondary	Hyperparathyroidism	BEFREE	12050253		★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	11550306, 16338976	Associate	★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	19751734	Stimulate	★☆☆☆☆ Found in Text Mining only
Hyperprolactinemia	Hyperprolactinemia	BEFREE	10374130, 11248741, 16475950, 28673122, 29895074, 30239770		★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	22479346, 30013445, 36739654	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertension	Hypertension	Pubtator	8822320	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertension Pulmonary	Pulmonary hypertension	Pubtator	28415932, 37731513	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	12791939, 23423640, 27613724, 28156155, 28164755, 28295976, 29113856, 29126188, 29511611, 29556095, 29574782, 29618021, 29921371, 29931048, 29936324, 29975581, 30934575, 31077177, 31327319, 31440920, 31663986, 31808026, 8822320		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	LHGDN	17211256, 18603571		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	CTD_human_DG	19502719, 22228705		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperthyroidism	Hyperthyroidism	LHGDN	18299470		★☆☆☆☆ Found in Text Mining only
Hyperthyroidism	Hyperthyroidism	Pubtator	26188228	Associate	★☆☆☆☆ Found in Text Mining only
Hyperthyroidism	Hyperthyroidism	BEFREE	27578200, 29172902, 30882687		★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	LHGDN	12135130		★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	23229189, 30029588, 9264495		★☆☆☆☆ Found in Text Mining only
Hypertrophic obstructive cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	11782760, 23229189, 30029588, 9264495		★☆☆☆☆ Found in Text Mining only
Hypertrophy	Hypertrophy	Pubtator	34143208	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypochondroplasia (disorder)	Hypochondroplasia	BEFREE	1879059, 22137367		★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	11956148, 1281841, 1311795, 16548790, 1697583, 17299065, 18270301, 20081321, 2170553, 27999108, 28110155, 28649085, 30376339, 7509217, 9479554, 9626125, 9692837		★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	Pubtator	1697608, 36742395	Associate	★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypogonadism	Hypogonadism	BEFREE	11344229, 28508601, 30239770, 30289304, 30840065		★☆☆☆☆ Found in Text Mining only
Hypogonadism	Hypogonadism	Pubtator	30098700, 37306894	Associate	★☆☆☆☆ Found in Text Mining only
Hypogonadism	Hypogonadism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypogonadotropic hypogonadism	Hypogonadotropic Hypogonadism	BEFREE	28423475		★☆☆☆☆ Found in Text Mining only
Hypopigmentation disorder	Hypopigmentation Disorder	BEFREE	30208515		★☆☆☆☆ Found in Text Mining only
Hypopituitarism	Hypopituitarism	BEFREE	27998919, 29609574, 8770900		★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	BEFREE	12373017, 18553546, 19064126, 23900776, 28672739, 30239770, 9832414		★☆☆☆☆ Found in Text Mining only
HYPOTRICHOSIS 6	Hypotrichosis	BEFREE	26096762		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	18234850, 24473145, 35457151	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	18772238, 27487118, 37731513	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxic-Ischemic Encephalopathy	Hypoxic-Ischemic Encephalopathy	BEFREE	29863263		★☆☆☆☆ Found in Text Mining only
Ichthyosis, X-Linked	Ichthyosis	BEFREE	10725783, 25858498, 9458358		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	11463599, 11776068, 15681824, 20067420, 8520779		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	17219718	Stimulate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	33672678	Associate	★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	1283288, 19268458, 21047277, 28668953, 29402846, 7870340		★☆☆☆☆ Found in Text Mining only
IIeocolitis	Ileocolitis	CTD_human_DG	19751734		★☆☆☆☆ Found in Text Mining only
Ileitis	Ileitis	BEFREE	21337672		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	26363004, 29110360		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	16340083, 17848918, 18198415, 23015654, 24074845, 24347322, 28198714, 28203146, 28932186, 29155799, 29233786, 31319676, 31338023, 31839419		★☆☆☆☆ Found in Text Mining only
Infantile Refsum Disease (disorder)	Infantile Refsum Disease	BEFREE	27886192		★☆☆☆☆ Found in Text Mining only
Infantile Severe Myoclonic Epilepsy	Myoclonic Epilepsy	BEFREE	29031192		★☆☆☆☆ Found in Text Mining only
Infantile Spasm	Infantile Spasms	BEFREE	30503720		★☆☆☆☆ Found in Text Mining only
Infarction, Middle Cerebral Artery	Cerebral Infraction	CTD_human_DG	25257527		★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	36303457	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	LHGDN	11914023		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	29343614, 29424780, 29893990, 29901552, 31159802		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	11172010, 18840925, 20378848, 22138333, 22476197, 24586785, 24845759, 26310818, 28478612, 29023587, 29074537, 33390804, 36325267, 8981937	Associate	★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	14556818	Stimulate	★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	31517621, 38018587	Inhibit	★☆☆☆☆ Found in Text Mining only
Insulin resistance - type A	Insulin resistance syndrome	BEFREE	9175764		★☆☆☆☆ Found in Text Mining only
Insulin-Like Growth Factor I Deficiency	Insulin-Like Growth Factor I Deficiency	BEFREE	10549306, 10770174, 17895313, 18359741, 19517134, 19876774, 20543555, 21274339, 21292919, 21396573, 22419735, 23182818, 23182819, 23596138, 23887143, 24043429, 27613724, 28124277, 28295976, 28472963, 28502327, 29644002, 30197657, 31539878, 31614333, 31732912, 31791247, 8374676		★☆☆☆☆ Found in Text Mining only
Insulin-Like Growth Factor I Deficiency	Insulin-Like Growth Factor I Deficiency	GENOMICS_ENGLAND_DG	14684690, 21396584, 8857020		★☆☆☆☆ Found in Text Mining only
Insulin-Like Growth Factor I Deficiency	Insulin-Like Growth Factor I Deficiency	ORPHANET_DG	14684690, 8857020		★☆☆☆☆ Found in Text Mining only
Insulin-Like Growth Factor I Deficiency	Insulin-Like Growth Factor I Deficiency	CLINVAR_DG	24389050		★☆☆☆☆ Found in Text Mining only
Insulin-Like Growth Factor I Deficiency	Insulin-Like Growth Factor I Deficiency	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Insulin-resistant diabetes mellitus	Insulin-resistant diabetes mellitus	BEFREE	22170795, 29395968		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	14671408, 20668042, 29637872		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intellectual Disability	Mental retardation	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	27075568, 33764282, 36175893	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	28537499, 30858307		★☆☆☆☆ Found in Text Mining only
Intervertebral disc disease	Intervertebral disc disease	Pubtator	25674216	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral disc disorder	Intervertebral Disc Disorder	BEFREE	25547527		★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal Diseases	BEFREE	29907597		★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	39273528	Associate	★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial Aneurysm	BEFREE	28587396		★☆☆☆☆ Found in Text Mining only
Intraepithelial Neoplasia	Intraepithelial Neoplasia	BEFREE	15538047		★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	25384883		★☆☆☆☆ Found in Text Mining only
Ischemic cardiomyopathy	Ischemic myocardial dysfunction	BEFREE	9264495		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	24005314, 24708646, 26556536, 28317235, 28596451, 28724170, 28833493, 31846748		★☆☆☆☆ Found in Text Mining only
Ischemic Stroke	Ischemic stroke	Pubtator	35163437	Inhibit	★☆☆☆☆ Found in Text Mining only
Isolated somatotropin deficiency	Isolated Somatotropin Deficiency	BEFREE	10468970, 11299517, 11836270, 15536017, 15583470, 17785695, 18303074, 18628516, 1879059, 19036620, 19844116, 20190537, 20231366, 20560985, 20679995, 21697646, 22026507, 2233903, 22549341, 22621959, 23436191, 23567489, 24458596, 25116472, 26485222, 27501283, 27520559, 28068655, 28150584, 28306165, 28332357, 28516748, 28596789, 28760908, 28977695, 29218459, 29496979, 29609574, 29649340, 29658834, 30197657, 30286459, 30352410, 30378780, 30645996, 30676998, 30884465, 31123147, 31715605, 31835104, 7509217, 8333769, 8770900, 9007336		★☆☆☆☆ Found in Text Mining only
Jacobsen Distal 11q Deletion Syndrome	Jacobsen Syndrome	BEFREE	15266617		★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	22205208, 30622975		★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	16899596		★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	19423729		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	12631341, 19139726, 37338602	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Diseases	Kidney Disease	BEFREE	16306374, 21047277, 27653449, 28668953, 29384065, 31352157		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Diseases	Kidney Disease	LHGDN	17387582, 18534134		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Diseases	Kidney Disease	CTD_human_DG	8825380		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure	Kidney Failure	BEFREE	31791247		★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	24178975	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	10499309, 26830766, 31556012, 9255221, 9541273, 9767523		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Acute	Kidney Failure	CTD_human_DG	7540432		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Chronic	Kidney Failure	CTD_human_DG	10198369		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Chronic	Kidney Failure	BEFREE	10620558, 22123209, 27653449, 29214734		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Neoplasm	Kidney Neoplasm	BEFREE	9215294		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	10748176	Associate	★☆☆☆☆ Found in Text Mining only
Large cell carcinoma of lung	Lung Carcinoma	BEFREE	17299065		★☆☆☆☆ Found in Text Mining only
Laron Syndrome	Laron Syndrome	BEFREE	10102073, 12083945, 15001582, 15132718, 15231299, 16372230, 16548790, 17148568, 17320443, 17350302, 17405847, 17728167, 17986822, 18462969, 18556960, 1934530, 20583548, 21968387, 22682630, 22751808, 23456957, 24143239, 2434036, 26401581, 27090428, 28073935, 2813379, 28502327, 28743110, 29208357, 29339473, 29482569, 29995632, 3031118, 31208077, 31320996, 7687170, 7744997, 7949596, 8333769, 9661642, 9829217		★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	31536667		★☆☆☆☆ Found in Text Mining only
LAURIN-SANDROW SYNDROME	Laurin-Sandrow syndrome	BEFREE	30016763		★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	19759555		★☆☆☆☆ Found in Text Mining only
Leigh Disease	Leigh syndrome	Pubtator	36549505	Inhibit	★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	12413982, 18439583, 19499404, 32372565, 9184179	Associate	★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	19012097	Stimulate	★☆☆☆☆ Found in Text Mining only
leiomyosarcoma	Leiomyosarcoma	BEFREE	2208134, 3409868		★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	BEFREE	27282338		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	10468998, 16778368, 17453918, 17652007, 25648584		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	16778368, 20007139, 25095896, 3291986	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	16778368, 17878402, 20007139, 34840706	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	16778368, 20007139, 24967962, 29276026, 30429106, 30774377		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	LHGDN	17581609		★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy Body Disease	BEFREE	19276553, 30903695		★☆☆☆☆ Found in Text Mining only
Leydig Cell Tumor	Leydig Cell Tumor	BEFREE	21769864		★☆☆☆☆ Found in Text Mining only
Linear atrophy	Atrophy	BEFREE	30845368		★☆☆☆☆ Found in Text Mining only
Lipoatrophy	Lipoatrophy	BEFREE	23867790		★☆☆☆☆ Found in Text Mining only
Lipodystrophy	Lipodystrophy	BEFREE	23867790, 30657911		★☆☆☆☆ Found in Text Mining only
liposarcoma	Liposarcoma	BEFREE	3779638		★☆☆☆☆ Found in Text Mining only
Liposarcoma, Dedifferentiated	liposarcoma	BEFREE	30441794		★☆☆☆☆ Found in Text Mining only
Liposarcoma, Myxoid	liposarcoma	BEFREE	28637688		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	1385103, 16487514, 16530734, 16871543, 16965600, 17030190, 17615245, 1846019, 20206398, 2170553, 22161861, 22895605, 23248036, 23651211, 23757355, 24272080, 24586785, 2463838, 2466561, 2475498, 25420499, 25564572, 25862856, 25998745, 26138883, 26156803, 26160280, 26936374, 27388576, 27614046, 28051262, 28107416, 28290049, 28389416, 28529580, 28627639, 28747084, 29113370, 29340101, 29470830, 29638204, 29702590, 29981339, 29989646, 30064393, 30784932, 31207081, 31441605, 31689787, 31819522, 7639583, 8706031		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	28284560		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	11849991, 12044524, 12603011, 17024107, 26826001, 27775431, 28125073, 28472963, 28678199, 29113370, 29395967, 30064393		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis	Liver Cirrhosis	LHGDN	16015705, 16868142, 17410466		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis	Liver cirrhosis	Pubtator	16015705, 25052889, 31690932	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis	Liver cirrhosis	Pubtator	30063751	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Diseases	Liver disease	Pubtator	36973824, 37981173	Associate	★☆☆☆☆ Found in Text Mining only
Liver Diseases Alcoholic	Liver disease	Pubtator	22577490	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	18202196	Associate	★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	1385103, 16487514, 1846019, 2170553, 2466561, 2475498, 27614046, 28389416		★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	17531227	Associate	★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	30018981		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	8626706	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	17219718, 9657575	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	1850606, 8520779		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	12011225		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	12142546, 20051100, 20565977, 22347413, 27384677, 28204826, 30604632, 33313952	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	1372941, 20399527, 21447628, 27384677, 27651310, 28330997		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	34646335	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	23989734, 29385899		★☆☆☆☆ Found in Text Mining only
Lymphangioleiomyomatosis	Lymphangiomyomatosis	BEFREE	11523698, 17592551		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	21904903, 27737962		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	26662570	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	32851683, 33229445	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphoid leukemia	Lymphoid leukemia	BEFREE	31207081		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	19423729, 25884514, 27518527, 27870006, 31177400, 31340850		★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	23478260	Associate	★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 1	Major Affective Disorder	BEFREE	21302346		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 2	Major Affective Disorder	BEFREE	21302346		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 4	Major Affective Disorder	BEFREE	21302346		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 6	Major Affective Disorder	BEFREE	21302346		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 7	Major Affective Disorder	BEFREE	21302346		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 8	Major Affective Disorder	BEFREE	21302346		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 9	Major Affective Disorder	BEFREE	21302346		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	25836355, 27527872, 31211752		★☆☆☆☆ Found in Text Mining only
Malignant Carcinoid Syndrome	Carcinoid tumor of intestine	BEFREE	10964166		★☆☆☆☆ Found in Text Mining only
Malignant Central Nervous System Neoplasm	Malignant neoplasm of the central nervous system	BEFREE	12271818		★☆☆☆☆ Found in Text Mining only
Malignant Childhood Neoplasm	Malignant Neoplasm	BEFREE	30645996		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	12271818		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	17634559, 23482325, 24608110, 25355701, 28613101		★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	BEFREE	21330319, 22555177		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	7664867		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of adrenal cortex	Adrenocortical carcinoma	BEFREE	30838516, 8669808		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10070856, 10099938, 10364250, 10642432, 10650934, 10766344, 10995036, 11245436, 11250706, 11479214, 11747348, 11768601, 11948015, 11955796, 12082019, 12115549, 12389335, 12554767, 12574821, 12610514, 12890810, 12970748, 1421420, 1421422, 1421423, 14520693, 15308584, 15386404, 15538047, 15585484, 15598771, 15668470, 15756256, 15756268, 15818613, 15922332, 15986122, 16214911, 16215864, 16284391, 16284492, 16306136, 16322331, 16332723, 16404426, 16475694, 1649393, 16533767, 16537700, 16584539, 16752221, 16795042, 17010055, 17043687, 17051426, 17063263, 17082888, 17133354, 17170218, 17311016, 17484040, 17561390, 17595785, 17651480, 17909257, 17972510, 18045956, 18064566, 18237549, 18444168, 18481170, 18596909, 18757322, 18785005, 18819936, 18827819, 18991569, 19002570, 19047149, 19229608, 19261680, 19418218, 19536088, 19543094, 19551864, 19597750, 19622619, 19786462, 19846909, 19865540, 20080972, 20089431, 20155489, 20204283, 20206441, 20634197, 20705284, 20810604, 2082190, 20825649, 21113804, 21168492, 21177763, 21217522, 21292829, 21390492, 21455574, 21455766, 21477610, 21480260, 21484083, 21525039, 2152773, 21541704, 21562710, 21567071, 21574055, 21595894, 21719561, 21723890, 2174437, 21854628, 21882221, 21888628, 21904903, 21908557, 22014575, 22020329, 22182837, 22217202, 22235273, 22297468, 22442272, 22551578, 22564703, 22739988, 22801219, 22895778, 22906881, 23075937, 23180020, 23250396, 23308200, 23348700, 23549953, 23628798, 23663564, 23686499, 23782942, 24039934, 24227890, 24310658, 24392142, 24503796, 2463838, 24686172, 25085903, 25241146, 25680198, 25743390, 25956506, 26100469, 26191333, 26276395, 26400847, 26621843, 26655502, 26898459, 26902691, 26936396, 27063095, 27213582, 27341075, 27353258, 2747657, 27742668, 28096479, 28223691, 28236033, 28296140, 28315227, 28369883, 28478612, 28551627, 28579830, 28617135, 28628857, 28656281, 28947975, 29074537, 29162853, 29180608, 29212236, 29253837, 29486622, 29910690, 30203578, 30229539, 30286782, 30293548, 30317122, 30320391, 30388235, 3041262, 30458886, 31317318, 31337427, 31490549, 3167228, 31771180, 3312244, 3731113, 7757999, 8595162, 8665514, 9010238, 9014838, 9527274, 9615787, 9735418		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	17520698, 18398872		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	11955796, 15917160, 17598937, 18006148, 21078522, 21168492, 22711307, 23402816, 26193427, 26802879, 27121258, 30137481, 31168597, 31320996, 7523316, 7527333, 7750475		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	20104520, 21082354, 22146489, 24599933, 24615087, 28596684		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	21154998, 21717907, 24608110, 27312358		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	22165963, 24115835, 26826001		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	10793110, 10974650, 12489029, 14559833, 15374981, 15514114, 16741161, 17134788, 17196841, 17277889, 17588222, 17598937, 18450319, 20051100, 20051101, 21447628, 21683689, 22347413, 23185474, 23454899, 23980150, 24008975, 24310658, 24615087, 25173427, 26342551, 26430715, 27344406, 27384677, 28330997, 28362176, 29017078, 29066738, 29712908, 30018981, 30158168, 30604632, 31083179, 31559898		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of nasopharynx	Nasopharyngeal carcinoma	BEFREE	17908353		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	15262997, 17341442, 18236213, 19699512, 19858071, 21726895, 22072919, 22094188, 22700681, 29922232, 31728045		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	15208677, 18777594, 19064563, 19509165, 21118808, 21565828, 21571866, 21819318, 21852217, 23980075, 24809702, 24986516, 26242412, 28608366, 28681154, 29549161, 29976975, 30599289, 30980109		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	10613344, 10737798, 10850457, 10961344, 11020056, 11145562, 11507082, 11597555, 11956160, 14633696, 14666684, 14673951, 14693733, 14694521, 14712493, 15586244, 15678496, 15694866, 15734965, 15753383, 15800934, 15816537, 15870705, 16061650, 16418515, 16639715, 16648498, 16970944, 17001312, 17065200, 17096324, 17163422, 17164371, 17166755, 17202144, 17346186, 17513150, 17724372, 17911177, 18163429, 18175332, 18381457, 18596909, 18615538, 18726972, 18785179, 19211828, 19250214, 19423539, 19455605, 19470786, 19491931, 19790231, 19932151, 20099974, 20484221, 20634197, 21062988, 21113804, 21487405, 21536469, 21667031, 21670894, 21887406, 22459122, 22495974, 22579549, 22777769, 23192379, 23341348, 23397154, 23526299, 23530598, 23720424, 24130778, 24177231, 24491388, 24586243, 24824313, 24904019, 25344862, 25569803, 25724697, 25906745, 26954072, 27020859, 27225428, 27693462, 28361446, 28447314, 28545426, 28551627, 28646365, 28732480, 28972962, 29044573, 29114882, 29476383, 29992746, 30014700, 30165429, 30846112, 30952709, 31312023, 31504635, 31755099, 8439954, 8855837, 9174122		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	16465378, 19208208, 24586243		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	19966862		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	CTD_human_DG	24353828		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	11677116, 16264263, 17972051, 18544998, 21075859, 21690232, 21854509, 25532910, 25596089, 26028075, 26068646, 26271669, 28714005, 28743112, 29069776, 29731870, 29844688, 29855536, 29973668, 30111747, 30922917, 31773340		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	14602779, 15098919, 18451066, 21123448, 30513575, 31177118		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	11453542, 11749868, 19415693, 20395438, 22859931, 24999188, 28123579, 28882129, 29393438, 29848696, 29971779, 31076571		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	CTD_human_DG	19415693		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10459850, 10725785, 10857553, 11439349, 11571630, 11768601, 11955796, 11988840, 12188907, 12356918, 12372843, 12550081, 12610293, 12624423, 12843187, 12890810, 14615489, 14710348, 14712493, 15098919, 15150088, 15262997, 15375378, 15549418, 15566314, 15570044, 15598771, 15635489, 15678496, 15781617, 15879687, 15956962, 16214911, 16264263, 16400188, 16404426, 16418517, 16448675, 17043687, 17082888, 17096324, 17102589, 17166755, 17196841, 17346184, 17399767, 17419944, 17588222, 17634559, 17651480, 17724372, 17908353, 17914107, 18006148, 18188667, 18237549, 18259951, 18297687, 18398029, 18398872, 18491370, 18598695, 18636198, 18790743, 18829562, 1893385, 18946478, 18989835, 19132750, 19139887, 19223521, 19243297, 19423729, 19444937, 19477944, 19491931, 19533369, 19597750, 19790231, 20051101, 20333644, 20399527, 20457905, 20810604, 20956999, 21113804, 21123950, 21154998, 21177763, 21292919, 21303951, 21330319, 21455574, 21854357, 21854509, 21963847, 22159423, 22241325, 22275271, 22415807, 22430216, 22481093, 22710713, 22720981, 22801219, 22894543, 22895778, 23182194, 23188799, 23526983, 23696648, 23857432, 23935131, 23990442, 23993096, 24039934, 24130778, 24276851, 24310658, 24382376, 24438088, 24608110, 24683100, 24751329, 24802266, 24853186, 24970814, 25018100, 25095896, 25175038, 25316432, 25384883, 25385818, 25388513, 25398592, 25569803, 25724697, 25743390, 26026165, 26068646, 26276395, 26452103, 26510816, 26655502, 26883276, 26886902, 27090428, 27125743, 27340866, 27341075, 2747657, 27749737, 27881235, 28088698, 28161121, 28275367, 28316059, 28348577, 28394183, 28427155, 28440368, 28477731, 28478612, 28528691, 28551627, 28581517, 28621564, 28625631, 28637688, 28655914, 28815409, 28881863, 29017078, 29044573, 29054976, 29069776, 29108282, 29169312, 29180608, 29232358, 29395968, 29486622, 29540831, 29549161, 29608283, 29731973, 29735545, 29843755, 29910690, 29922232, 29971779, 30064393, 30069455, 30111277, 30147674, 30165429, 30191956, 30257507, 30445141, 30453495, 30500870, 30572549, 30654740, 30873591, 30952709, 30968148, 31076997, 31089868, 31158304, 31177118, 31185505, 31539362, 31545400, 31567197, 31713485, 31725675, 31847392, 8833657, 8910616, 9458358, 9615787, 9671770		★☆☆☆☆ Found in Text Mining only
Malignant Squamous Cell Neoplasm	Neoplasm	BEFREE	25896444		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	15262997, 16400188, 18199731, 25384883, 27206217, 30429055		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	11920634, 12374697, 12379772, 12485928, 14633695, 15247132, 15688407, 16053920, 16448675, 19533369, 19608011, 20001499, 20504360, 21406062, 21638027, 21720213, 22565227, 24182354, 25398592, 26503233, 26840943, 2747657, 27737962, 29895971, 29907597, 30003309, 30257507, 30952709, 31341157, 9731515		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	13129676, 16612111, 19477944, 21059918, 23721057, 23980167, 24375890, 27933679, 29178313, 29395967, 31159248, 8793418		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	LHGDN	15292338		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	Pubtator	24178975	Associate	★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	Pubtator	36973824	Inhibit	★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	17520698, 18398872		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12555073, 15221971, 15548698, 15756256, 15986122, 16161053, 16306136, 17010055, 17051426, 17063263, 17066319, 17082888, 17133354, 17166846, 17520698, 18045956, 18316619, 18375957, 18596909, 18757322, 18762812		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	17520698, 18398872		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	18452152, 21177763, 21462085, 2152773, 21562710, 21882221, 22020329, 22287600, 22297468, 25085903, 25178514, 28656281, 29180608, 29212519, 29253837, 30388235, 30692633, 7757999		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	17520698, 18398872		★☆☆☆☆ Found in Text Mining only
Manic	Manic Disorder	BEFREE	30336492		★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	21330319, 22555177		★☆☆☆☆ Found in Text Mining only
MATURITY-ONSET DIABETES OF THE YOUNG, TYPE 3 (disorder)	Mason type diabetes	BEFREE	12031966		★☆☆☆☆ Found in Text Mining only
McCune-Albright Syndrome	McCune-Albright Syndrome	BEFREE	29672904		★☆☆☆☆ Found in Text Mining only
Meckel syndrome type 1	Meckel Syndrome	BEFREE	16189249		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	11439349, 11911248, 12060623, 15195141, 20692232, 27255663		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	18546270, 27255663	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	12729801, 18079751, 18237549		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	18079751, 21654344, 23349796, 28092675, 28928360, 30355711, 32150843, 36303457	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	18237549, 20417200, 21654344, 22894899, 25940796, 26463631, 26497996, 28440508, 28928360, 30191956		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	1370435, 18562769, 19235591		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	LHGDN	19235591		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	19056428, 24878678, 25836355, 27527872, 28439104, 28594820, 28833493, 29031771, 29787856, 29865234, 30063009, 30278200, 8938649		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	PSYGENET_DG	21524689, 22189158, 24878678, 25151093, 25583186		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental disorders	Mental Disorders	BEFREE	14671408		★☆☆☆☆ Found in Text Mining only
Mental Retardation	Mental retardation	BEFREE	14671408, 20668042, 29637872		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	22323052, 27384677, 9479554		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	27384677	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	12612292	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Bone Disorder	Metabolic Bone Disorder	CTD_human_DG	11014614		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Diseases	Metabolic Diseases	BEFREE	17537658, 23867790, 25923102, 28164755, 29626501		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	39354608	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	20378848	Inhibit	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	22479346, 29504525, 31086127, 32548700, 34078313	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	29266696	Stimulate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	14671408, 16189249, 17202144, 20378848, 22479346, 24956249, 26487705, 27644646, 28287842, 28351623, 28646158, 29144802, 29460133, 30122909		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	LHGDN	18535190		★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	7687762		★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	11145562, 15368471, 16648498, 28292957		★☆☆☆☆ Found in Text Mining only
Microangiopathy, Diabetic	Diabetic cardiomyopathy	BEFREE	14741777, 17033268		★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	BEFREE	19838731, 23392101, 23428682		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Microcephaly	Microcephaly	HPO_DG			★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Micrognathism	Micrognathism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Micropenis	Micropenis	BEFREE	30840065		★☆☆☆☆ Found in Text Mining only
Middle Cerebral Artery Thrombosis	Cerebral Thrombosis	CTD_human_DG	25257527		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	28951235		★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	23015654, 25467636, 26402757, 28073325, 31319676, 31385821		★☆☆☆☆ Found in Text Mining only
Mild Mental Retardation	Mental retardation	HPO_DG			★☆☆☆☆ Found in Text Mining only
Miller-McKusick-Malvaux-Syndrome (3M Syndrome)	3M Syndrome	BEFREE	23018678		★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	CTD_human_DG	18539642		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	15556609, 28821609	Associate	★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	18079751	Inhibit	★☆☆☆☆ Found in Text Mining only
Mixed anxiety and depressive disorder	Mixed Anxiety And Depressive Disorder	BEFREE	31787098		★☆☆☆☆ Found in Text Mining only
Monoclonal Gammopathy of Undetermined Significance	Monoclonal Gammapathies	BEFREE	27111220		★☆☆☆☆ Found in Text Mining only
Motor neuron atrophy	Motor neuron atrophy	BEFREE	24814151		★☆☆☆☆ Found in Text Mining only
Motor Neuron Disease	Motor Neuron Disease	BEFREE	12645079, 16005636, 19679066, 26311784, 9851658		★☆☆☆☆ Found in Text Mining only
Motor Neuron Disease	Motor Neuron Disease	LHGDN	17116217		★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	35421271	Associate	★☆☆☆☆ Found in Text Mining only
Moyamoya Disease	Moyamoya disease	Pubtator	30157848	Associate	★☆☆☆☆ Found in Text Mining only
Mucinous Adenocarcinoma	Mucinous Adenocarcinoma	BEFREE	21161940		★☆☆☆☆ Found in Text Mining only
Mucoepidermoid Carcinoma	Mucoepidermoid Carcinoma	BEFREE	25647264		★☆☆☆☆ Found in Text Mining only
Multinodular goiter	Multinodular goiter	BEFREE	29081797		★☆☆☆☆ Found in Text Mining only
Multiple Endocrine Neoplasia Type 1	Multiple Endocrine Neoplasia	BEFREE	8644767, 9681845		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	10029602, 11122111, 11175262, 12010818, 12391322, 14504085, 14592826, 14726660, 15319277, 16728278, 16951388, 17644731, 17823079, 18830264, 19124510, 19191868, 19228610, 20844560, 21799925, 23632478, 24713927, 30408155, 35536760, 35546402, 37499483, 8822946	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	12097303, 12149650, 14592826, 14726660, 15070698, 15087402, 16044163, 17419944, 19124510, 19228610, 19284554, 20086250, 20844560, 22348393, 22955917, 23138182, 24713927, 25050627, 26935956, 27111220, 29254208, 31190579, 8822946		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	LHGDN	16044163, 19124510		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	19284554	Inhibit	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	10980132, 16120466, 27982500, 28363754, 28427698, 28460598		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	29504525	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis, Relapsing-Remitting	Multiple Sclerosis	BEFREE	28460598		★☆☆☆☆ Found in Text Mining only
MUNGAN SYNDROME	MUNGAN SYNDROME	BEFREE	26381604		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy	Muscular dystrophy	BEFREE	16463438, 16716629, 17531227, 20494600, 22664740, 24396035		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	18215180, 24575400		★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	BEFREE	25627031		★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia gravis	Pubtator	30696470	Associate	★☆☆☆☆ Found in Text Mining only
Myelodysplasia	Myelodysplasia	BEFREE	22465474		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	20569071, 22465474, 26469401		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	LHGDN	18246120		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	16953217, 18246120, 19508387, 31747806, 7589339, 7690436, 8820990		★☆☆☆☆ Found in Text Mining only
MYELOPROLIFERATIVE SYNDROME, TRANSIENT	Myeloproliferative disorder	BEFREE	10940495		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	11246885, 11735233, 11937187, 12086966, 16635594, 17062892, 19850049, 21039458, 21708381, 23712705, 24604065, 25678113, 26363004, 29042931, 30210678, 30365087, 30497090, 31116952, 31555539, 31607475, 31808500		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial infarction	Pubtator	11246885, 21039458	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	LHGDN	16635594, 16955207, 18451573, 18703768		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	BEFREE	12505877, 14671411, 21039458, 21664162		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	LHGDN	14715837		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	CTD_human_DG	16214533		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial ischemia	Pubtator	21039458, 21664162	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myopathy	Myopathy	BEFREE	12621363, 31039163		★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	BEFREE	20435602, 21976954, 22509095, 23734076, 27044882, 27167306, 29771404		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myopia	Myopia	Pubtator	20435602, 21976954, 22509095, 22509107, 31776299, 36338665, 38287803	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myopia	Myopia	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myositis	Myositis	BEFREE	22664740, 30140235		★☆☆☆☆ Found in Text Mining only
Myositis Inclusion Body	Myositis	Pubtator	16405511	Associate	★☆☆☆☆ Found in Text Mining only
MYOTONIC DYSTROPHY 1	Myotonic dystrophy	BEFREE	29189984, 29767287		★☆☆☆☆ Found in Text Mining only
Myxoid/Round Cell Liposarcoma	Myxoid Liposarcoma	BEFREE	28637688		★☆☆☆☆ Found in Text Mining only
Myxoma of heart	Myxoma Of Heart	BEFREE	23715723, 26156800, 26563368		★☆☆☆☆ Found in Text Mining only
Myxoma of the Endocardium	Myxoma Of The Endocardium	BEFREE	23715723, 26156800, 26563368		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	18202785		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	15608666, 17908353, 27656832, 28143425, 28865599, 30745576, 31467485		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	28143425, 28865599, 34544905, 36973940	Associate	★☆☆☆☆ Found in Text Mining only
Necrotizing Enterocolitis	Necrotizing Enterocolitis	BEFREE	29131241		★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	29131241		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10218991, 10425444, 10468998, 10470113, 10535406, 10611309, 10737798, 10789725, 10821217, 10845811, 10881027, 10935510, 10937058, 10961344, 11071655, 11146233, 11344219, 11472074, 11504910, 11507082, 11523698, 11550306, 11677116, 11694654, 11787734, 11874695, 11889599, 11904318, 11920625, 11972303, 12008749, 12057025, 12060623, 12111694, 12355407, 12374697, 12545204, 12593846, 12919156, 1314098, 1314781, 1370435, 14520693, 14633721, 14673951, 14710354, 14710367, 15026620, 15095405, 15477708, 15661050, 15754342, 15867218, 15876410, 15956962, 15994346, 16015705, 16035620, 16166331, 16168116, 16214911, 16305477, 16400188, 16530734, 16596194, 16752221, 16779663, 16815029, 1694748, 16965600, 16969385, 1697567, 16998819, 17030190, 1713573, 17196841, 17295243, 17299065, 17332914, 17346187, 17399767, 17588166, 17588222, 17594522, 17598937, 17909257, 17914107, 17972510, 18026134, 18045956, 18199731, 18245484, 18299461, 18391632, 18491370, 18611974, 18642089, 18827819, 18854392, 19132750, 19172414, 19229591, 19267401, 19423729, 19508387, 19608011, 19632948, 20001499, 20099280, 20335450, 20399527, 20457905, 20543862, 20685857, 20692232, 21047978, 21145998, 21161940, 21217522, 21480260, 21562710, 21625219, 21722151, 2174908, 21873172, 21882221, 21960694, 22019901, 22020329, 22044563, 2208134, 22086503, 22146489, 22159423, 22162472, 22165963, 22217202, 22235273, 22240890, 22406993, 22438913, 22508822, 22508827, 22551578, 22585092, 22720981, 22739988, 22801219, 22894899, 22895605, 22895778, 23038625, 23180020, 23182194, 23196330, 23226206, 23248036, 23266446, 23349796, 23351020, 23431408, 23453369, 23576565, 23674160, 23685749, 23689072, 23933187, 23940012, 23972545, 24026884, 24056966, 24130778, 24392142, 24416386, 24438088, 24599933, 24667688, 24809702, 24846856, 25008035, 25175038, 25304103, 25344862, 25473182, 25569803, 25613038, 25637790, 25797030, 25839904, 25896444, 26043748, 26156800, 26160280, 26242412, 26268733, 26271669, 26405092, 26429980, 26497996, 26698305, 26738606, 26876199, 26943587, 27121258, 27144430, 27267848, 27340866, 2747657, 27614046, 27681944, 27778296, 27858572, 2786436, 28107416, 28118269, 28205047, 28236033, 28258988, 28316059, 28328831, 28396686, 28440368, 28447314, 28613101, 28624790, 28625007, 28731178, 28744395, 28887782, 28895413, 28928360, 28944896, 29073591, 29081797, 29108282, 29255466, 29291019, 29299904, 29339473, 29385899, 29427754, 29524179, 29568964, 29638204, 29644002, 29725014, 29844094, 29848696, 29854305, 29910690, 29922232, 29925553, 29941485, 29963105, 29971779, 29983893, 30003309, 30047091, 30069455, 30074936, 30134795, 30158168, 30200644, 30213025, 30231881, 3029761, 30376339, 30429055, 30448582, 30458886, 30531694, 30540560, 30594912, 30627944, 30657911, 30689967, 30692633, 30742299, 30760858, 30774377, 30784932, 30851160, 30867789, 31034883, 31059193, 31125088, 31158304, 31177118, 31185266, 31208077, 31341157, 31398922, 31455425, 31523190, 31536667, 31545400, 31594825, 31604330, 31669471, 31677093, 31701145, 31702045, 3185662, 3409868, 3779638, 7547225, 7664867, 7861768, 8069850, 8083365, 8174129, 8370710, 8557160, 8593783, 8823750, 8833657, 9081364, 9099954, 9135074, 9199203, 9215294, 9368001, 9458358, 9615787, 9671770, 9681845, 9683796, 9692837, 9723878, 9809814, 9809981		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	11145562, 20820871, 21123950, 31035970, 31341157, 9215294		★☆☆☆☆ Found in Text Mining only
Nephrogenic Diabetes Insipidus, Type I	Nephrogenic Diabetes Insipidus	BEFREE	18553546		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	28210955, 28954393, 30981749		★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural Tube Defect	BEFREE	30430336		★☆☆☆☆ Found in Text Mining only
Neurilemmoma	Neurilemmoma	BEFREE	22821509		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	10383152, 10498893, 10889510, 11571630, 11587536, 11746362, 11874695, 12553057, 1331680, 15256055, 15654842, 15719172, 15930297, 15994346, 16133873, 16618748, 18706205, 18973876, 19167357, 19477940, 20963499, 2174908, 22875931, 23710710, 24003223, 24349301, 30718793, 30833285, 30986444, 8477653, 8813151, 9200735, 9404729, 9563481, 9795362, 9852124		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	10567913, 11228049, 16133873, 17156427, 35887076, 7986393	Associate	★☆☆☆☆ Found in Text Mining only
Neurocognitive Disorders	Neurocognitive Disorders	BEFREE	20818790		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	11172010, 36577365	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	LHGDN	14647921		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	23804751, 24054991, 25102325, 26311784, 27142684, 27245680, 28203146, 28334990, 29029433, 29739805, 29740270, 30450079, 30903695, 31563149		★☆☆☆☆ Found in Text Mining only
Neuroectodermal Tumor, Primitive	Neuroectodermal Tumors	BEFREE	10675492, 2174908, 8054516		★☆☆☆☆ Found in Text Mining only
Neuroectodermal Tumors	Neuroectodermal Tumors	BEFREE	2174908		★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	10964166, 15580291, 16601284, 29213282		★☆☆☆☆ Found in Text Mining only
Neuromuscular Diseases	Neuromuscular Diseases	BEFREE	11526451, 20157530		★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	30179684, 30221656		★☆☆☆☆ Found in Text Mining only
Nevi and Melanomas	Congenital melanocytic nevus syndrome	BEFREE	7978067		★☆☆☆☆ Found in Text Mining only
Niemann-Pick Disease, Type B	Niemann-Pick Disease	BEFREE	12712061		★☆☆☆☆ Found in Text Mining only
Nijmegen Breakage Syndrome	Nijmegen Breakage Syndrome	BEFREE	12147227		★☆☆☆☆ Found in Text Mining only
Nodular glomerulosclerosis	Glomerulosclerosis	BEFREE	10426384		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	23931760, 24716226, 27135827, 27889912, 28125073, 28678199, 28927302, 29341046, 29395967, 29575055, 29724029, 30063751, 30592792, 31243652, 31690932		★☆☆☆☆ Found in Text Mining only
Non-Functioning Pituitary Gland Neoplasm	Pituitary adenoma	BEFREE	29228199, 29498920, 29975580		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	12068000, 1372941, 14633721, 15374967, 15618451, 18762365, 19632946, 19632948, 20047843, 20145156, 21447628, 21717907, 21980128, 22038047, 22359227, 23266446, 23619944, 23915069, 24289561, 24438088, 24485233, 24745618, 25617986, 25944691, 26342551, 27177336, 27213344, 27584082, 28330997, 28460483, 28715819, 28731178, 28742836, 28946136, 29253515, 30190423, 30604632, 31083179, 31152452, 31348244, 31366504, 31413745, 31523190, 8675593		★☆☆☆☆ Found in Text Mining only
NONAKA MYOPATHY	Inclusion body myopathy	BEFREE	29743626, 8557160		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	30206761, 30592792, 31243652		★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	28483103		★☆☆☆☆ Found in Text Mining only
Noonan Syndrome	Noonan Syndrome	BEFREE	20029239, 23624134, 29659837		★☆☆☆☆ Found in Text Mining only
Noonan Syndrome	Noonan syndrome	Pubtator	23624134	Associate	★☆☆☆☆ Found in Text Mining only
Norrie disease	Norrie Disease	BEFREE	18024814		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	16306374, 17030965, 17320443, 18785179, 19680783, 19786462, 19876774, 20105189, 20504360, 21968387, 22241325, 23374718, 24690978, 26100469, 26401581, 26732027, 26741958, 27307439, 27749711, 27749737, 28164755, 28244645, 28478612, 28744309, 28771488, 28772093, 28987875, 29023587, 29080965, 29150385, 29201918, 29679919, 29921371, 29950119, 30295509, 30317122, 30350467, 30445141, 30576246, 30753672, 31029141, 31146894, 31527400, 8300045, 8374676, 8769133, 8770900, 9207075		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	18308828, 19786462, 20504360, 23150676, 24690978, 26741958, 28474384, 28478612, 29023587, 31086127, 31517621, 32835719, 35703718, 36384443, 39266979	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	40528195	Stimulate	★☆☆☆☆ Found in Text Mining only
Obsessive-Compulsive Disorder	Obsessive-Compulsive Disorder	BEFREE	31515486		★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	17639047, 17909257, 21273576, 21939528, 22429491, 22551578, 27765027, 31490549		★☆☆☆☆ Found in Text Mining only
Oligospermia	Oligospermia	BEFREE	29195026		★☆☆☆☆ Found in Text Mining only
Ophthalmoplegia	Ophthalmoplegia	Pubtator	30696470	Associate	★☆☆☆☆ Found in Text Mining only
Opsoclonus-Myoclonus Syndrome	Opsoclonus-myoclonus syndrome	BEFREE	30718793		★☆☆☆☆ Found in Text Mining only
Osteitis Fibrosa Disseminata	Fibrous dysplasia	BEFREE	29672904		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	15082485, 15882567, 17129375, 19036616, 19180501, 19762915, 22160392, 23036517, 23322062, 23546957, 24361742, 30365099, 32832544, 33639898, 34143208, 9771213	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	20633672, 24155249	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	33027520	Inhibit	★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	33027520	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	28599103, 30899364		★☆☆☆☆ Found in Text Mining only
Osteochondrodysplasias	Osteochondrodysplasia	LHGDN	17363178		★☆☆☆☆ Found in Text Mining only
Osteogenesis Imperfecta	Osteogenesis Imperfecta	BEFREE	8241674		★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	CTD_human_DG	11014614		★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	11122154, 21322098, 28236062, 28475811, 29343614, 30018240, 30593432, 31581477		★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	10599704, 15256976, 15261847, 15592793, 16183214, 26191288, 26214445, 26600491, 29474865, 29498081, 29747606, 30273601, 30847871, 31147813, 31489803, 9744989		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	LHGDN	18301972		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	26191288, 26214445, 26600491, 29745905, 32080087, 34363732, 35758378, 36316863	Associate	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	38260127	Inhibit	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Osteoporosis, Age-Related	Osteoporosis	BEFREE	7876328		★☆☆☆☆ Found in Text Mining only
Osteoporosis, Postmenopausal	Osteoporosis	BEFREE	29113980		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	10226783, 11325513, 12037623, 15095405, 19132750, 19229591, 21866554, 22454254, 24063281, 26463566, 26698867, 26759259, 26845446, 27931832, 28551627, 28744395, 28844074, 29232358, 29568964, 30217668, 30406034, 30489194, 31542501, 31545400, 8052269, 8054516, 8123049, 8281940, 9492043, 9578515		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	10234573, 15969240, 25075009, 29232358, 35575588, 36438897	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	LHGDN	14710359		★☆☆☆☆ Found in Text Mining only
Osteosclerosis	Osteosclerosis	Pubtator	9593772	Associate	★☆☆☆☆ Found in Text Mining only
Otosclerosis	Otosclerosis	BEFREE	31148391		★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	21726895		★☆☆☆☆ Found in Text Mining only
Ovarian clear cell carcinoma	Ovarian Carcinoma	BEFREE	26360832		★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	17341442, 21846690, 38275748	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	12237896, 18236213		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	15262997, 17341442, 18236213, 19699512, 19858071, 22094188, 22700681, 29922232, 31728045		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	15262997, 17341442, 19858071, 23857432, 25290091, 26360832, 29910195, 31865146, 35739532, 7939173, 8624265	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	21726895	Stimulate	★☆☆☆☆ Found in Text Mining only
Oxyphilic Adenoma	Oxyphilic Adenoma	BEFREE	15661050		★☆☆☆☆ Found in Text Mining only
PACHYONYCHIA CONGENITA 3	Pachyonychia Congenita	BEFREE	11920625, 12111694		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	15208677, 18777594, 19064563, 19509165, 21118808, 21565828, 21571866, 21819318, 21852217, 23980075, 24809702, 26242412, 28608366, 28681154, 29549161, 29976975, 30599289, 30980109		★☆☆☆☆ Found in Text Mining only
Pancreatic Diseases	Pancreatic diseases	Pubtator	12641820	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	22086503, 29901181		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	17975158, 19064563		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	28249168		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	12641820	Stimulate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	14521721, 15155719, 19064563, 19874825, 20416304, 20663861, 21118808, 26310818, 27487118, 30799278, 32398667, 8260363	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	12641820	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	28499807, 28854965		★☆☆☆☆ Found in Text Mining only
Panhypopituitarism	Panhypopituitarism	BEFREE	11299517, 18805914, 28332357, 30378782		★☆☆☆☆ Found in Text Mining only
Papillary adenoma	Papillary Adenoma	CTD_human_DG	1611713		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	23288662, 25329702, 28328831, 29200876, 29890543, 31177118, 31579073		★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	BEFREE	10749124, 17622350, 9135074		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	18061591, 19276553, 19470380, 26657015, 28221705, 29065116, 29515352, 29865234, 30450079, 30903695, 31331066		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	19305504, 26967642	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	37159450	Stimulate	★☆☆☆☆ Found in Text Mining only
Paroxysmal nocturnal hemoglobinuria	Paroxysmal nocturnal hemoglobinuria	BEFREE	28630090		★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	17666408		★☆☆☆☆ Found in Text Mining only
Pediatric Obesity	Childhood obesity	BEFREE	16824679, 30634949		★☆☆☆☆ Found in Text Mining only
Pelvic Organ Prolapse	Pelvic organ prolapse	Pubtator	34432732	Inhibit	★☆☆☆☆ Found in Text Mining only
Penis agenesis	Penis Agenesis	BEFREE	30840065		★☆☆☆☆ Found in Text Mining only
Peptic Esophagitis	Peptic Esophagitis	BEFREE	20403354		★☆☆☆☆ Found in Text Mining only
Pericardial effusion	Pericardial effusion	BEFREE	19968998		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	31398715, 31478163		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	31398715	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	30221656, 30431101		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Peripheral Nervous System Diseases	Nervous System Diseases	CTD_human_DG	8866126, 9452187		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	30221656, 30431101		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Peyronie Disease	Peyronie Disease	BEFREE	27107083		★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	Pubtator	23106811	Associate	★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	30213025, 31185266		★☆☆☆☆ Found in Text Mining only
Pick Disease of the Brain	Pica	BEFREE	30903695		★☆☆☆☆ Found in Text Mining only
PIGMENTARY DISORDER, RETICULATE, WITH SYSTEMIC MANIFESTATIONS	Pigmentary Disorder, Reticulate, With Systemic Manifestations	BEFREE	11910526		★☆☆☆☆ Found in Text Mining only
Pituitary Adenoma	Pituitary adenoma	BEFREE	15104560, 28390436, 30843342		★☆☆☆☆ Found in Text Mining only
Pituitary Adenoma	Pituitary adenoma	CTD_human_DG	1611713		★☆☆☆☆ Found in Text Mining only
Pituitary carcinoma	Pituitary carcinoma	CTD_human_DG	1611713		★☆☆☆☆ Found in Text Mining only
Pituitary Diseases	Pituitary Diseases	BEFREE	10746655, 15266617, 2707163, 29065431, 29886481		★☆☆☆☆ Found in Text Mining only
Pituitary dwarfism	Pituitary dwarfism	BEFREE	11299517, 1879059, 20190537, 22026507, 2233903, 22549341, 23436191, 25116472, 28332357, 30865930, 31835104, 7509217, 8333769		★☆☆☆☆ Found in Text Mining only
PITUITARY DWARFISM I	Pituitary dwarfism	BEFREE	7509217		★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary Neoplasms	CTD_human_DG	1611713		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	18840925	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pituitary Neoplasms	Pituitary Neoplasms	BEFREE	27974387		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	33752302	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pleural effusion disorder	Pleural effusion	LHGDN	12102164		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	BEFREE	23864113		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	LHGDN	17396115		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	BEFREE	23864113, 27653449		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	11955796, 14556818, 19318457, 20452586, 20926690, 23750031, 26802879, 28673204, 28684382, 29030491, 29363717, 29430464, 29595066, 30300681, 30374732, 30968585, 31099269, 31733099, 8654631, 8772565		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	14556818, 18840925, 26979943, 29363717, 35551681, 35758378, 37155307, 37737665, 8654631	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	LHGDN	15653207, 15950665, 17320874		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	20452586, 27174569	Stimulate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	39796177	Inhibit	★☆☆☆☆ Found in Text Mining only
Polycythemia	Polycythemia	BEFREE	29222208		★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	BEFREE	16239216, 7589339, 9414643		★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	16239216	Associate	★☆☆☆☆ Found in Text Mining only
Polyendocrinopathies, Autoimmune	Autoimmune Polyendocrinopathy	BEFREE	28164139		★☆☆☆☆ Found in Text Mining only
Polymicrogyria	Polymicrogyria	BEFREE	20560985		★☆☆☆☆ Found in Text Mining only
Polyp of large intestine	Polyp Of Large Intestine	BEFREE	19784788, 20580999, 21728395, 25385818		★☆☆☆☆ Found in Text Mining only
Porphyria Acute Intermittent	Porphyria	Pubtator	19570056	Associate	★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	28158790		★☆☆☆☆ Found in Text Mining only
Prader-Willi Syndrome	Prader-Willi Syndrome	BEFREE	16030173, 22052808, 28427039, 29496979, 30380028, 31454785		★☆☆☆☆ Found in Text Mining only
Prader-Willi-like syndrome	Prader-Willi-Like Syndrome	BEFREE	29496979		★☆☆☆☆ Found in Text Mining only
Precocious pubarche	Precocious Pubarche	BEFREE	17442315		★☆☆☆☆ Found in Text Mining only
Precocious Puberty	Precocious puberty	CTD_human_DG	21402727		★☆☆☆☆ Found in Text Mining only
Precocious Puberty	Precocious puberty	BEFREE	29303010		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	26159252		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	26450156, 27532210		★☆☆☆☆ Found in Text Mining only
Prelingual sensorineural hearing impairment	Sensorineural hearing loss	HPO_DG			★☆☆☆☆ Found in Text Mining only
Premature adrenarche	Premature adrenarche	BEFREE	29163361, 30042733		★☆☆☆☆ Found in Text Mining only
Premature aging syndrome	Premature aging	BEFREE	18195102, 25274775, 31156709		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	CTD_human_DG	15750215		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	16983186, 20821386, 24820016, 28123476, 29065116, 29155799, 30809143		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	15256976		★☆☆☆☆ Found in Text Mining only
Primary hyperoxaluria type 1	Hyperoxaluria	Pubtator	27161247	Associate	★☆☆☆☆ Found in Text Mining only
Progeria	Progeria	BEFREE	29907918		★☆☆☆☆ Found in Text Mining only
Progressive hearing loss stapes fixation	Hearing loss with stapes fixation	Pubtator	31166600	Stimulate	★☆☆☆☆ Found in Text Mining only
Progressive pseudorheumatoid dysplasia	Progressive Pseudorheumatoid Dysplasia	BEFREE	17363178		★☆☆☆☆ Found in Text Mining only
Progressive supranuclear palsy	Progressive Supranuclear Palsy	BEFREE	30903695		★☆☆☆☆ Found in Text Mining only
Prolactinoma	Prolactinoma	BEFREE	29728863, 29895074, 29987187, 30198429		★☆☆☆☆ Found in Text Mining only
Proliferative diabetic retinopathy	Proliferative Diabetic Retinopathy	BEFREE	11910526		★☆☆☆☆ Found in Text Mining only
Prostate cancer familial	Prostate cancer	Pubtator	29095436	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	10613344, 10737798, 10850457, 10961344, 11020056, 11145562, 11507082, 11597555, 11956160, 14633696, 14673951, 14693733, 14694521, 14712493, 15586244, 15678496, 15694866, 15734965, 15753383, 15800934, 15816537, 15870705, 16061650, 16418515, 16639715, 16648498, 16970944, 17001312, 17065200, 17096324, 17163422, 17164371, 17166755, 17202144, 17346186, 17513150, 17724372, 17911177, 18163429, 18175332, 18381457, 18596909, 18615538, 18726972, 18785179, 19211828, 19250214, 19423539, 19455605, 19470786, 19491931, 19790231, 19932151, 20099974, 20484221, 20634197, 21062988, 21113804, 21487405, 21536469, 21667031, 21670894, 21887406, 22459122, 22495974, 22579549, 22777769, 23192379, 23341348, 23397154, 23526299, 23530598, 23720424, 24130778, 24177231, 24491388, 24586243, 2468269, 24824313, 24904019, 25344862, 25569803, 25724697, 25906745, 26954072, 27020859, 27225428, 27693462, 28361446, 28447314, 28545426, 28551627, 28646365, 28732480, 28972962, 29114882, 29476383, 29762647, 29992746, 30014700, 30165429, 30846112, 30952709, 31312023, 31504635, 31755099, 8855837, 9174122, 9671770		★☆☆☆☆ Found in Text Mining only
Prostatic Diseases	Prostatic Diseases	BEFREE	17202144		★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic Hyperplasia	LHGDN	12111701, 16820871		★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	26400665, 29129118, 34606081, 37501430, 37705744	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic Hyperplasia	BEFREE	29460133, 9215294		★☆☆☆☆ Found in Text Mining only
Prostatic Hypertrophy	Prostatic Hypertrophy	BEFREE	29603556		★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	BEFREE	14666684, 24297183		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	11020056, 15816537, 16465378, 16847815, 16970944, 17143537, 17668637, 17878531, 18163429, 18446056, 18475308, 18507013, 19018764, 19544333, 19596919, 20484221, 21031436, 21606419, 23341348, 23530598, 24564736, 24586243, 24824313, 24885093, 24904019, 25683512, 28157714, 30165429, 30871495, 32433882, 33734457, 36931467, 37463569, 38087324	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	12122101, 12746292, 12843187, 16820871, 16847815, 17096324, 17911177		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	15311059, 18381457, 21062988, 21960694, 22777769, 28292957, 28440368, 30134795, 31312023		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	16465378, 19208208, 24586243		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	16884534, 20197460, 28732480, 33252839	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	21983635	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Proteinuria	Proteinuria	Pubtator	18441509	Stimulate	★☆☆☆☆ Found in Text Mining only
Pseudohyperkalemia Cardiff	Pseudohyperkalemia Cardiff	BEFREE	16804965, 17410466, 30105830		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	10802619, 11214819, 19519316, 21241374, 21687694, 9347796		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	28483103		★☆☆☆☆ Found in Text Mining only
Ptosis	Ptosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	17573449, 20110400, 34266334	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	18415806	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	28886998		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	CTD_human_DG	15286697		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	15618451, 19004037, 20081067, 22923639, 26953888, 31291549		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Fibrosis	Pulmonary Fibrosis	LHGDN	19004037		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	37731513	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pycnodysostosis	Pycnodysostosis	BEFREE	9007336		★☆☆☆☆ Found in Text Mining only
Rabson-Mendenhall Syndrome	Rabson-Mendenhall Syndrome	BEFREE	11757582, 17560154		★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	25473182, 27681944, 31702045		★☆☆☆☆ Found in Text Mining only
Regional enteritis	Crohn Disease	CTD_human_DG	19751734		★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	10499309		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	10499309, 15661050, 21625219, 23548153, 27226530, 27976731, 28453463, 28484923, 30271170, 30862574		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	LHGDN	15086466, 15661050		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	31361542		★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	9690042		★☆☆☆☆ Found in Text Mining only
Renal tubular disorder	Renal Tubular Disorder	BEFREE	23229189		★☆☆☆☆ Found in Text Mining only
Resistance to Insulin-Like Growth Factor I	IGF-I RESISTANCE	BEFREE	15476454, 18819936, 19574224, 24116170, 24820016, 25066218, 25202993, 26369544, 26936374, 27729281, 28051262, 28193878, 28898232, 29195026, 29212519, 29217764, 29249625, 29398400, 29922232, 30116397, 31114545, 31340202		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	22923639, 26427594, 29545181		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	12813019, 16437130, 18997086, 21056995, 21057375, 29663652, 30093937, 31567197		★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	BEFREE	30026694		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	14681231, 28943916, 8910531		★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy of prematurity	Pubtator	11331770, 37803473, 40084286	Associate	★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy	BEFREE	15135797, 16362313, 16500767, 17567756, 18050122, 21057375, 27529840, 28506724, 28872709, 28934640, 28937236, 28969546, 29181317, 29274846, 30093937, 30461053, 30471715, 30914019, 31106420, 31272307, 31486831, 31564208		★☆☆☆☆ Found in Text Mining only
Rett Syndrome	Rett Syndrome	BEFREE	24419315, 28007906, 28110691, 29560377, 30277526		★☆☆☆☆ Found in Text Mining only
Rett Syndrome	Rett syndrome	Pubtator	24419315, 28007906	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdoid Tumor	Rhabdoid Tumor	BEFREE	18641990		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	10973962, 12082533, 12942549, 18391632, 23079386, 23255356, 2476983, 7686519, 9537584		★☆☆☆☆ Found in Text Mining only
Rheumatic Heart Disease	Rheumatic Heart Disease	BEFREE	16406300		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	11083281, 16406300, 22839688, 23232804, 24816316, 25352179, 27695067, 27775453, 28583713, 28682648, 30509997, 30892152, 31028998, 31327319, 31430609, 7738951		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	18666027		★☆☆☆☆ Found in Text Mining only
Rickets	Rickets	BEFREE	30885216		★☆☆☆☆ Found in Text Mining only
Right ventricular failure	Ventricular Failure	BEFREE	27013635		★☆☆☆☆ Found in Text Mining only
Right Ventricular Hypertrophy	Ventricular hypertrophy	BEFREE	29511611		★☆☆☆☆ Found in Text Mining only
Robinow Syndrome	Robinow Syndrome	BEFREE	9826209		★☆☆☆☆ Found in Text Mining only
Russell-Silver syndrome	Russell-Silver Syndrome	BEFREE	12387515, 18230663, 22170793, 25066218, 28675902		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	11463599, 20081321, 8520779, 9698597		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	17219718	Stimulate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	10725783, 12355407, 19013896, 21565828, 21717907, 22787122, 25858498, 28744395, 9458358		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	LHGDN	14710346, 18648544		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	20179209, 26402468	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	15282325, 20485667, 22798295	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	11994280	Associate	★☆☆☆☆ Found in Text Mining only
Sarcopenia	Sarcopenia	Pubtator	18240972, 34544407	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	17044098, 18973876, 19394958, 28110691, 29137928, 31839419		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	33274367	Inhibit	★☆☆☆☆ Found in Text Mining only
SEBASTIAN SYNDROME	SEBASTIAN SYNDROME	BEFREE	9202662		★☆☆☆☆ Found in Text Mining only
Seckel syndrome	Seckel Syndrome	GENOMICS_ENGLAND_DG	8857020		★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	22294722, 26405092, 28369940, 29123263		★☆☆☆☆ Found in Text Mining only
Sensorineural Hearing Loss (disorder)	Hearing Loss	BEFREE	10831862, 15953522, 19838731, 21396584, 23428682, 28373074, 30682699		★☆☆☆☆ Found in Text Mining only
Sensorineural Hearing Loss (disorder)	Hearing Loss	HPO_DG			★☆☆☆☆ Found in Text Mining only
Sensorineural hearing loss, bilateral	Sensorineural hearing loss	HPO_DG			★☆☆☆☆ Found in Text Mining only
Sensory neuropathy	Sensory neuropathy	BEFREE	30823517		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	28673002, 29969314, 30774344		★☆☆☆☆ Found in Text Mining only
Severe myopia	Myopia	BEFREE	20435602, 21976954, 22332214, 22509095, 23734076, 26076017, 27044882, 27167306, 28135889		★☆☆☆☆ Found in Text Mining only
SHORT STATURE, IDIOPATHIC, X-LINKED	SHORT STATURE, IDIOPATHIC, X-LINKED	BEFREE	12217488, 26400282		★☆☆☆☆ Found in Text Mining only
Sick Sinus Syndrome	Sick Sinus Syndrome	BEFREE	29306561		★☆☆☆☆ Found in Text Mining only
SIMPSON-GOLABI-BEHMEL SYNDROME, TYPE 1	Simpson-Golabi-Behmel Syndrome	BEFREE	21687707		★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	19404300	Associate	★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	29771405	Associate	★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	29771405		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	16452250		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Skin Neoplasms	Skin Neoplasms	CTD_human_DG	24353828		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Skin Neoplasms	Skin neoplasm	Pubtator	34836359	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sleep Apnea Syndromes	Sleep Apnea	BEFREE	30066288		★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	LHGDN	12509920, 17721831		★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	26260848, 28384333, 29388045, 29441807, 29458693, 29931465, 30554705, 31778943		★☆☆☆☆ Found in Text Mining only
Sleep Deprivation	Sleep deprivation	Pubtator	23490203	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Deprivation	Sleep deprivation	Pubtator	25373853	Inhibit	★☆☆☆☆ Found in Text Mining only
Sleep Disorders	Sleep Disorders	BEFREE	31787098		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	1372941, 15746061, 23515613, 23640142, 24316558, 30405782, 31083179, 31324758, 7539317		★☆☆☆☆ Found in Text Mining only
Soft Tissue Neoplasms	Soft Tissue Neoplasms	BEFREE	29731738		★☆☆☆☆ Found in Text Mining only
Somatotropin deficiency	Somatotropin Deficiency	BEFREE	12035938, 12161480, 15583470, 16030173, 18805914, 21207066, 21396573, 22026507, 22350661, 23567489, 24124081, 24458596, 27520559, 27982500, 28099132, 28150584, 28306165, 28516748, 28574152, 28596789, 28760908, 28802353, 28947559, 29496979, 29536433, 29609574, 29649340, 29658834, 29671202, 29982753, 30197657, 30286459, 30332395, 30352410, 30418584, 30645996, 30884465, 30988753, 31100717, 31123147, 31301056, 31417499, 31661639, 31715605, 31842524, 9007336		★☆☆☆☆ Found in Text Mining only
Spastic cerebral palsy	Spastic Cerebral Palsy	BEFREE	28236062		★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophy	Spinal Muscular Atrophy	BEFREE	21325354, 21979052, 22669476, 24814151, 26311784		★☆☆☆☆ Found in Text Mining only
Spondylarthritis	Spondyloarthritis	BEFREE	27695067		★☆☆☆☆ Found in Text Mining only
Sporadic Breast Carcinoma	Breast Carcinoma	BEFREE	18045956, 21455766, 24162448		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	18781172		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	20047843, 20104520, 24485233, 24810113, 25896444, 25944691, 28551677, 28946136		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	17183068, 22146489, 24026884, 25358597, 25363593, 28498434, 29207170		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	18836279, 32899449	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	16499871, 21980128, 22113431, 24802266, 25355701, 25945837, 28551677		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	CTD_human_DG	30594912		★☆☆☆☆ Found in Text Mining only
ST segment elevation myocardial infarction	ST Segment Elevation Myocardial Infarction	BEFREE	29898838		★☆☆☆☆ Found in Text Mining only
Stable angina	Stable Angina	BEFREE	9264495		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	23351407, 24716226, 28125073, 29065431, 29724029, 30130150, 30206761, 31690932		★☆☆☆☆ Found in Text Mining only
Steroid Sulfatase Deficiency Disease	Steroid Sulfatase Deficiency Disease	BEFREE	10725783, 25858498, 9458358		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	11677116, 14612496, 15929170, 16264263, 1693565, 17972051, 18544998, 21075859, 21690232, 21854509, 25532910, 25596089, 26028075, 26068646, 26271669, 28714005, 28743112, 29069776, 29731870, 29844688, 29855536, 29973668, 30922917, 31773340		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	11404775, 21075859, 21690232, 21854509, 23755751, 24885194, 26068646, 26271669, 27144430, 27437872, 31151932, 31773340, 32147868, 36774408, 37909722	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	15929170	Stimulate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	23861230	Inhibit	★☆☆☆☆ Found in Text Mining only
Strabismus	Strabismus	Pubtator	36338665	Associate	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	16361587, 32065979	Associate	★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	15726267		★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	16247461, 18855347, 25613038, 30909453		★☆☆☆☆ Found in Text Mining only
Systemic onset juvenile chronic arthritis	Arthritis	BEFREE	11606449, 12373010		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	19004037		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	LHGDN	19004037		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	25884514, 28656297, 31340850		★☆☆☆☆ Found in Text Mining only
TARSAL-CARPAL COALITION SYNDROME	Tarsal-Carpal Coalition Syndrome	BEFREE	21347663		★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	30450079		★☆☆☆☆ Found in Text Mining only
Telangiectasia Hereditary Hemorrhagic	Hereditary hemorrhagic telangiectasia	Pubtator	30512964	Stimulate	★☆☆☆☆ Found in Text Mining only
Telomeric 22q13 Monosomy Syndrome	22q13 monosomy syndrome	Pubtator	24132240, 35093163, 35395866, 36833418, 37003575	Associate	★☆☆☆☆ Found in Text Mining only
Testicular dysgenesis	Testicular dysgenesis	BEFREE	31141788		★☆☆☆☆ Found in Text Mining only
Testicular Feminization	Testicular Feminization	BEFREE	11600534, 12876417		★☆☆☆☆ Found in Text Mining only
Testotoxicosis	Testotoxicosis	CTD_human_DG	21402727		★☆☆☆☆ Found in Text Mining only
Thrombocythemia Essential	Essential thrombocythemia	Pubtator	23243278	Associate	★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	BEFREE	31479555		★☆☆☆☆ Found in Text Mining only
Thymic Carcinoma	Thymic Carcinoma	BEFREE	31097100		★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	25628226, 31097100		★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	22159761, 27987211, 28222462, 28938449, 29273685, 29631510, 31127272, 31313753, 31399042		★☆☆☆☆ Found in Text Mining only
Thyroid cancer medullary	Medullary thyroid cancer	Pubtator	1483875	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	30786680, 32851683, 34537745	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	14602779, 15098919, 16305477, 17346187, 18451066, 21123448, 30513575, 31177118, 7547225		★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	1802682, 34184083	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid Diseases	BEFREE	29081797, 29593792		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	10937058, 14602779, 18451066, 21123448, 30513575, 31177118		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	LHGDN	15098919		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	30786680	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Nodule	Thyroid Nodule	BEFREE	20886414, 23288662, 29081797, 30745501, 31077177		★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	Pubtator	12733712	Associate	★☆☆☆☆ Found in Text Mining only
Tongue Neoplasms	Tongue cancer	Pubtator	8493451	Inhibit	★☆☆☆☆ Found in Text Mining only
Transient Cerebral Ischemia	Cerebral Ischemia	BEFREE	29257289		★☆☆☆☆ Found in Text Mining only
Transient Ischemic Attack	Transient Ischemic Attack	BEFREE	29257289		★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	21347663		★☆☆☆☆ Found in Text Mining only
Trichohepatoenteric Syndrome	Trichohepatoenteric Syndrome	BEFREE	11600534, 15001582, 22768670, 7744997		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	21177763, 21677874, 23689072, 25824321, 26232605, 28046018, 30458886, 30632005, 31001629, 31518138		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	21677874, 25824321, 32169310, 32325700, 40528195	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	24167614	Stimulate	★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous Sclerosis	BEFREE	17592551, 18193272, 18958173, 25695134, 30503720		★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous sclerosis complex	Pubtator	17592551, 18958173	Associate	★☆☆☆☆ Found in Text Mining only
Tubular Aggregate Myopathy	Tubular Aggregate Myopathy	BEFREE	10940495		★☆☆☆☆ Found in Text Mining only
Tumors of Adrenal Cortex	Tumors Of Adrenal Cortex	BEFREE	10425444, 14710363, 18611974		★☆☆☆☆ Found in Text Mining only
Turner Syndrome	Turner Syndrome	BEFREE	12050253, 16291706, 17067837, 17540594, 23567489, 28095041, 29392348, 9100570		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	29907597		★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	25836355		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	32420368, 32570217, 33888644, 35896848	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	20395438, 22859931		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	15262997, 18781172, 25384883, 34253194, 34551673	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	23464477	Stimulate	★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	30643822	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	11006320, 12413982, 15922007, 19012097, 19499404, 1979007, 2208134, 26546520, 26884457, 28875276, 7507128, 7573249, 7684390, 9184179		★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	19032678	Associate	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	20061986, 27881235, 28118269, 31508890		★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	31508890	Stimulate	★☆☆☆☆ Found in Text Mining only
Varicose Veins	Varicose veins	Pubtator	34746972	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	LHGDN	14604834		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	17033268, 21785846, 26712712, 28164755		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	34363732, 9152314	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular arrhythmia	Ventricular arrhythmia	BEFREE	31555539		★☆☆☆☆ Found in Text Mining only
Ventricular Dysfunction	Ventricular dysfunction	Pubtator	21931616	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular Dysfunction Left	Ventricular dysfunction	Pubtator	17010800	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular Septal Defects	Ventricular septal defect	BEFREE	17300770		★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin D Deficiency	BEFREE	28372721, 29470176, 30885216, 31281588		★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	30208515		★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	30208515		★☆☆☆☆ Found in Text Mining only
Von Hippel-Lindau Syndrome	Von Hippel-Lindau Syndrome	BEFREE	21625219		★☆☆☆☆ Found in Text Mining only
West Syndrome	West Syndrome	BEFREE	30503720		★☆☆☆☆ Found in Text Mining only
Williams Syndrome	Williams syndrome	Pubtator	33564861	Associate	★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	11212886	Associate	★☆☆☆☆ Found in Text Mining only