Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	347735
Gene name	Serine incorporator 2
Gene symbol	SERINC2
Synonyms (NCBI Gene)	FKSG84PRO0899TDE2TDE2L
Chromosome	1
Chromosome location	1p35.2

Show/Hide all (79)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016907	hsa-miR-335-5p	Microarray	18185580
MIRT1338081	hsa-miR-1184	CLIP-seq
MIRT1338082	hsa-miR-1205	CLIP-seq
MIRT1338083	hsa-miR-124	CLIP-seq
MIRT1338084	hsa-miR-1286	CLIP-seq
MIRT1338085	hsa-miR-1908	CLIP-seq
MIRT1338086	hsa-miR-3158-5p	CLIP-seq
MIRT1338087	hsa-miR-3194-3p	CLIP-seq
MIRT1338088	hsa-miR-3675-5p	CLIP-seq
MIRT1338089	hsa-miR-3917	CLIP-seq
MIRT1338090	hsa-miR-4268	CLIP-seq
MIRT1338091	hsa-miR-4283	CLIP-seq
MIRT1338092	hsa-miR-4293	CLIP-seq
MIRT1338093	hsa-miR-4448	CLIP-seq
MIRT1338094	hsa-miR-4489	CLIP-seq
MIRT1338095	hsa-miR-4493	CLIP-seq
MIRT1338096	hsa-miR-4525	CLIP-seq
MIRT1338097	hsa-miR-4722-5p	CLIP-seq
MIRT1338098	hsa-miR-4725-5p	CLIP-seq
MIRT1338099	hsa-miR-504	CLIP-seq
MIRT1338100	hsa-miR-506	CLIP-seq
MIRT1338101	hsa-miR-663	CLIP-seq
MIRT1338102	hsa-miR-760	CLIP-seq
MIRT1338103	hsa-miR-1224-5p	CLIP-seq
MIRT1338092	hsa-miR-4293	CLIP-seq
MIRT1338104	hsa-miR-4420	CLIP-seq
MIRT1338105	hsa-miR-4687-3p	CLIP-seq
MIRT1338106	hsa-miR-4728-5p	CLIP-seq
MIRT1338107	hsa-miR-4736	CLIP-seq
MIRT1338108	hsa-miR-4751	CLIP-seq
MIRT1338109	hsa-miR-486-3p	CLIP-seq
MIRT1338110	hsa-miR-544b	CLIP-seq
MIRT1338111	hsa-miR-647	CLIP-seq
MIRT1338112	hsa-miR-657	CLIP-seq
MIRT1338113	hsa-miR-668	CLIP-seq
MIRT2099904	hsa-miR-148a	CLIP-seq
MIRT2099905	hsa-miR-148b	CLIP-seq
MIRT2099906	hsa-miR-152	CLIP-seq
MIRT2099907	hsa-miR-3158-3p	CLIP-seq
MIRT2099908	hsa-miR-3189-5p	CLIP-seq
MIRT2099909	hsa-miR-3591-3p	CLIP-seq
MIRT2099910	hsa-miR-371-3p	CLIP-seq
MIRT2099911	hsa-miR-4276	CLIP-seq
MIRT2099912	hsa-miR-4286	CLIP-seq
MIRT2099913	hsa-miR-4318	CLIP-seq
MIRT2099914	hsa-miR-4685-5p	CLIP-seq
MIRT2099915	hsa-miR-4733-3p	CLIP-seq
MIRT2099916	hsa-miR-4758-3p	CLIP-seq
MIRT2099917	hsa-miR-873	CLIP-seq
MIRT2324827	hsa-miR-1207-5p	CLIP-seq
MIRT1338083	hsa-miR-124	CLIP-seq
MIRT2324828	hsa-miR-1275	CLIP-seq
MIRT2099907	hsa-miR-3158-3p	CLIP-seq
MIRT2324829	hsa-miR-3191	CLIP-seq
MIRT2324830	hsa-miR-331-3p	CLIP-seq
MIRT2099909	hsa-miR-3591-3p	CLIP-seq
MIRT2324831	hsa-miR-3612	CLIP-seq
MIRT1338091	hsa-miR-4283	CLIP-seq
MIRT2324832	hsa-miR-4292	CLIP-seq
MIRT1338104	hsa-miR-4420	CLIP-seq
MIRT2324833	hsa-miR-4459	CLIP-seq
MIRT1338096	hsa-miR-4525	CLIP-seq
MIRT2324834	hsa-miR-4537	CLIP-seq
MIRT2324835	hsa-miR-4665-5p	CLIP-seq
MIRT2099914	hsa-miR-4685-5p	CLIP-seq
MIRT2324836	hsa-miR-4695-5p	CLIP-seq
MIRT1338097	hsa-miR-4722-5p	CLIP-seq
MIRT2324837	hsa-miR-4723-5p	CLIP-seq
MIRT2099915	hsa-miR-4733-3p	CLIP-seq
MIRT1338107	hsa-miR-4736	CLIP-seq
MIRT2324838	hsa-miR-4763-3p	CLIP-seq
MIRT2324839	hsa-miR-4795-5p	CLIP-seq
MIRT1338100	hsa-miR-506	CLIP-seq
MIRT2324840	hsa-miR-625	CLIP-seq
MIRT2324841	hsa-miR-637	CLIP-seq
MIRT2324842	hsa-miR-650	CLIP-seq
MIRT2324843	hsa-miR-665	CLIP-seq
MIRT1338113	hsa-miR-668	CLIP-seq
MIRT2099917	hsa-miR-873	CLIP-seq

Show/Hide all (9)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005886	Component	Plasma membrane	IDA	37474505
GO:0005886	Component	Plasma membrane	IEA
GO:0006658	Process	Phosphatidylserine metabolic process	IEA
GO:0010698	Function	Acetyltransferase activator activity	IEA
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0017121	Process	Plasma membrane phospholipid scrambling	IDA	37474505
GO:0017128	Function	Phospholipid scramblase activity	IDA	37474505
GO:0070062	Component	Extracellular exosome	HDA	19056867

MIM	HGNC	e!Ensembl
614549	23231	ENSG00000168528

Q96SA4

Protein name

Serine incorporator 2 (Tumor differentially expressed protein 2-like)

Protein function

Non-ATP-dependent, non-specific lipid transporter for phosphatidylserine, phosphatidylcholine, and phosphatidylethanolamine. Functions as a scramblase that flips lipids in both directions across the membrane. In contrast to SERINC3 and SERINC5,

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03348	Serinc	16 → 453	Serine incorporator (Serinc)	Family

Sequence

MGACLGACSLLSCASCLCGSAPCILCSCCPASRNSTVSRLIFTFFLFLGVLVSIIMLSPG
VESQLYKLPWVCEEGAGIPTVLQGHIDCGSLLGYRAVYRMCFATAAFFFFFTLLMLCVSS
SRDPRAAIQNGFWFFKFLILVGLTVGAFYIPDGSFTNIWFYFGVVGSFLFILIQLVLLID
FAHSWNQRWLGKAEECDSRAWYAGLFFFTLLFYLLSIAAVALMFMYYTEPSGCHEGKVFI
SLNLTFCVCVSIAAVLPKVQDAQPNSGLLQASVITLYTMFVTWSALSSIPEQKCNPHLPT
QLGNETVVAGPEGYETQWWDAPSIVGLIIFLLCTLFISLRSSDHRQVNSLMQTEECPPML
DATQQQQQVAACEGRAFDNEQDGVTYSYSFFHFCLVLASLHVMMTLTNWYKPGETRKMIS
TWTAVWVKICASWAGLLLYLWTLVAPLLLRNRDFS

Sequence length

455

Interactions

View interactions

	Reactome
			Serine biosynthesis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CHRONIC LYMPHOCYTIC LEUKEMIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HODGKINS LYMPHOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE MYELOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (18)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	30405754		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	28935972	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	28935972		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	30405754		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia Vascular	Vascular dementia	Pubtator	40624693	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial hyperplasia	Pubtator	34943992	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	32642801	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	32642801	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	40449756	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	35069789	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	33143730	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	24424505		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	12949800		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	30405754		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	24424505		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	12949800		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pervasive Development Disorder	Autism spectrum disorder	BEFREE	28935972		★★★★★ ★☆☆☆☆ Found in Text Mining only
Testicular Neoplasms	Testicular Neoplasms	BEFREE	12949800		★★★★★ ★☆☆☆☆ Found in Text Mining only

SERINC2 (serine incorporator 2)