Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	347734
Gene name	Solute carrier family 35 member B2
Gene symbol	SLC35B2
Synonyms (NCBI Gene)	HLD26PAPST1SLLUGTrel4
Chromosome	6
Chromosome location	6p21.1
Summary	Sulfotransferases (e.g., SULT4A1; MIM 608359) use an activated form of sulfate, 3-prime-phosphoadenosine 5-prime-phosphosulfate (PAPS), as a common sulfate donor for sulfation of glycoproteins, proteoglycans, and glycolipids in the endoplasmic reticulum a

118

Show/Hide all (118)

miRTarBase ID	miRNA	Experiments	Reference
MIRT027098	hsa-miR-103a-3p	Sequencing	20371350
MIRT030466	hsa-miR-24-3p	Microarray	19748357
MIRT030466	hsa-miR-24-3p	Sequencing	20371350
MIRT031660	hsa-miR-16-5p	Sequencing	20371350
MIRT031660	hsa-miR-16-5p	Proteomics	18668040
MIRT495653	hsa-miR-4714-5p	PAR-CLIP	22291592
MIRT495652	hsa-miR-483-5p	PAR-CLIP	22291592
MIRT495651	hsa-miR-3921	PAR-CLIP	22291592
MIRT495650	hsa-miR-4653-5p	PAR-CLIP	22291592
MIRT495649	hsa-miR-4522	PAR-CLIP	22291592
MIRT495653	hsa-miR-4714-5p	PAR-CLIP	22291592
MIRT495652	hsa-miR-483-5p	PAR-CLIP	22291592
MIRT495651	hsa-miR-3921	PAR-CLIP	22291592
MIRT495650	hsa-miR-4653-5p	PAR-CLIP	22291592
MIRT495649	hsa-miR-4522	PAR-CLIP	22291592
MIRT495653	hsa-miR-4714-5p	PAR-CLIP	22291592
MIRT495652	hsa-miR-483-5p	PAR-CLIP	22291592
MIRT495651	hsa-miR-3921	PAR-CLIP	22291592
MIRT495650	hsa-miR-4653-5p	PAR-CLIP	22291592
MIRT495649	hsa-miR-4522	PAR-CLIP	22291592
MIRT495653	hsa-miR-4714-5p	PAR-CLIP	22291592
MIRT495652	hsa-miR-483-5p	PAR-CLIP	22291592
MIRT495651	hsa-miR-3921	PAR-CLIP	22291592
MIRT495650	hsa-miR-4653-5p	PAR-CLIP	22291592
MIRT495649	hsa-miR-4522	PAR-CLIP	22291592
MIRT1360320	hsa-miR-2467-3p	CLIP-seq
MIRT1360321	hsa-miR-298	CLIP-seq
MIRT1360322	hsa-miR-3120-3p	CLIP-seq
MIRT1360323	hsa-miR-3154	CLIP-seq
MIRT1360324	hsa-miR-3179	CLIP-seq
MIRT1360325	hsa-miR-3665	CLIP-seq
MIRT1360326	hsa-miR-3678-3p	CLIP-seq
MIRT1360327	hsa-miR-4257	CLIP-seq
MIRT1360328	hsa-miR-4678	CLIP-seq
MIRT1360329	hsa-miR-657	CLIP-seq
MIRT1360330	hsa-miR-922	CLIP-seq
MIRT2106619	hsa-miR-103a	CLIP-seq
MIRT2106620	hsa-miR-107	CLIP-seq
MIRT2106621	hsa-miR-1238	CLIP-seq
MIRT2106622	hsa-miR-1243	CLIP-seq
MIRT2106623	hsa-miR-1262	CLIP-seq
MIRT2106624	hsa-miR-1343	CLIP-seq
MIRT2106625	hsa-miR-15a	CLIP-seq
MIRT2106626	hsa-miR-15b	CLIP-seq
MIRT2106627	hsa-miR-16	CLIP-seq
MIRT2106628	hsa-miR-195	CLIP-seq
MIRT2106629	hsa-miR-29a	CLIP-seq
MIRT2106630	hsa-miR-29b	CLIP-seq
MIRT2106631	hsa-miR-29c	CLIP-seq
MIRT2106632	hsa-miR-3065-3p	CLIP-seq
MIRT2106633	hsa-miR-31	CLIP-seq
MIRT2106634	hsa-miR-3124-3p	CLIP-seq
MIRT2106635	hsa-miR-3153	CLIP-seq
MIRT2106636	hsa-miR-3620	CLIP-seq
MIRT2106637	hsa-miR-3654	CLIP-seq
MIRT2106638	hsa-miR-412	CLIP-seq
MIRT2106639	hsa-miR-424	CLIP-seq
MIRT2106640	hsa-miR-4310	CLIP-seq
MIRT2106641	hsa-miR-4426	CLIP-seq
MIRT2106642	hsa-miR-4436b-3p	CLIP-seq
MIRT2106643	hsa-miR-4646-5p	CLIP-seq
MIRT2106644	hsa-miR-4647	CLIP-seq
MIRT2106645	hsa-miR-4662b	CLIP-seq
MIRT2106646	hsa-miR-4667-3p	CLIP-seq
MIRT2106647	hsa-miR-4668-5p	CLIP-seq
MIRT2106648	hsa-miR-4696	CLIP-seq
MIRT2106649	hsa-miR-4701-3p	CLIP-seq
MIRT2106650	hsa-miR-4761-3p	CLIP-seq
MIRT2106651	hsa-miR-497	CLIP-seq
MIRT2106652	hsa-miR-7	CLIP-seq
MIRT2106653	hsa-miR-767-5p	CLIP-seq
MIRT2106619	hsa-miR-103a	CLIP-seq
MIRT2106620	hsa-miR-107	CLIP-seq
MIRT2330918	hsa-miR-1193	CLIP-seq
MIRT2106621	hsa-miR-1238	CLIP-seq
MIRT2106624	hsa-miR-1343	CLIP-seq
MIRT2106625	hsa-miR-15a	CLIP-seq
MIRT2106626	hsa-miR-15b	CLIP-seq
MIRT2106627	hsa-miR-16	CLIP-seq
MIRT2106628	hsa-miR-195	CLIP-seq
MIRT1360321	hsa-miR-298	CLIP-seq
MIRT2106629	hsa-miR-29a	CLIP-seq
MIRT2106630	hsa-miR-29b	CLIP-seq
MIRT2106631	hsa-miR-29c	CLIP-seq
MIRT2106632	hsa-miR-3065-3p	CLIP-seq
MIRT1360322	hsa-miR-3120-3p	CLIP-seq
MIRT2106634	hsa-miR-3124-3p	CLIP-seq
MIRT2106635	hsa-miR-3153	CLIP-seq
MIRT1360323	hsa-miR-3154	CLIP-seq
MIRT1360324	hsa-miR-3179	CLIP-seq
MIRT2330919	hsa-miR-331-3p	CLIP-seq
MIRT2106636	hsa-miR-3620	CLIP-seq
MIRT2330920	hsa-miR-3689a-3p	CLIP-seq
MIRT2330921	hsa-miR-3689c	CLIP-seq
MIRT2330922	hsa-miR-370	CLIP-seq
MIRT2106638	hsa-miR-412	CLIP-seq
MIRT2106639	hsa-miR-424	CLIP-seq
MIRT1360327	hsa-miR-4257	CLIP-seq
MIRT2106640	hsa-miR-4310	CLIP-seq
MIRT2330923	hsa-miR-4437	CLIP-seq
MIRT2330924	hsa-miR-4469	CLIP-seq
MIRT2106643	hsa-miR-4646-5p	CLIP-seq
MIRT2106646	hsa-miR-4667-3p	CLIP-seq
MIRT2106647	hsa-miR-4668-5p	CLIP-seq
MIRT1360328	hsa-miR-4678	CLIP-seq
MIRT2330925	hsa-miR-4728-5p	CLIP-seq
MIRT2106651	hsa-miR-497	CLIP-seq
MIRT2330926	hsa-miR-541	CLIP-seq
MIRT2330927	hsa-miR-654-5p	CLIP-seq
MIRT2106653	hsa-miR-767-5p	CLIP-seq
MIRT1360330	hsa-miR-922	CLIP-seq
MIRT2106632	hsa-miR-3065-3p	CLIP-seq
MIRT2394731	hsa-miR-3155	CLIP-seq
MIRT2394732	hsa-miR-3155b	CLIP-seq
MIRT2394733	hsa-miR-4438	CLIP-seq
MIRT2394734	hsa-miR-484	CLIP-seq
MIRT2394735	hsa-miR-490-5p	CLIP-seq
MIRT2106632	hsa-miR-3065-3p	CLIP-seq

Show/Hide all (27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IBA
GO:0000139	Component	Golgi membrane	IDA	12716889
GO:0000139	Component	Golgi membrane	IEA
GO:0000139	Component	Golgi membrane	IEA
GO:0000139	Component	Golgi membrane	TAS
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005789	Component	Endoplasmic reticulum membrane	IBA
GO:0005794	Component	Golgi apparatus	IDA	12716889, 35325049
GO:0005794	Component	Golgi apparatus	IEA
GO:0005802	Component	Trans-Golgi network	IEA
GO:0015297	Function	Antiporter activity	IEA
GO:0016020	Component	Membrane	IDA	12716889
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	NAS	12716889
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	HMP	12761501
GO:0046963	Process	3'-phosphoadenosine 5'-phosphosulfate transport	IBA
GO:0046963	Process	3'-phosphoadenosine 5'-phosphosulfate transport	IDA	12716889
GO:0046964	Function	3'-phosphoadenosine 5'-phosphosulfate transmembrane transporter activity	IBA
GO:0046964	Function	3'-phosphoadenosine 5'-phosphosulfate transmembrane transporter activity	IDA	12716889
GO:0046964	Function	3'-phosphoadenosine 5'-phosphosulfate transmembrane transporter activity	IEA
GO:0046964	Function	3'-phosphoadenosine 5'-phosphosulfate transmembrane transporter activity	TAS
GO:0050650	Process	Chondroitin sulfate proteoglycan biosynthetic process	IMP	35325049
GO:0055085	Process	Transmembrane transport	IBA
GO:0055085	Process	Transmembrane transport	IEA
GO:1902558	Process	5'-adenylyl sulfate transmembrane transport	IEA
GO:1902558	Process	5'-adenylyl sulfate transmembrane transport	TAS
GO:1902559	Process	3'-phospho-5'-adenylyl sulfate transmembrane transport	IEA

MIM	HGNC	e!Ensembl
610788	16872	ENSG00000157593

Q8TB61

Protein name

Adenosine 3'-phospho 5'-phosphosulfate transporter 1 (PAPS transporter 1) (Putative MAPK-activating protein PM15) (Putative NF-kappa-B-activating protein 48) (Solute carrier family 35 member B2)

Protein function

Probably functions as a 3'-phosphoadenylyl sulfate:adenosine 3',5'-bisphosphate antiporter at the Golgi membranes. Mediates the transport from the cytosol into the lumen of the Golgi of 3'-phosphoadenylyl sulfate/adenosine 3'-phospho 5'-phosphos

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF08449	UAA	111 → 412	UAA transporter family	Family

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in the placenta, pancreas, mammary gland and skeletal muscle. Weakly or not expressed in colon, heart and prostate (PubMed:12716889). Expressed in the brain, predominantly in frontal lobe gray matter, subcortical front

Sequence

MDARWWAVVVLAAFPSLGAGGETPEAPPESWTQLWFFRFVVNAAGYASFMVPGYLLVQYF
RRKNYLETGRGLCFPLVKACVFGNEPKASDEVPLAPRTEAAETTPMWQALKLLFCATGLQ
VSYLTWGVLQERVMTRSYGATATSPGERFTDSQFLVLMNRVLALIVAGLSCVLCKQPRHG
APMYRYSFASLSNVLSSWCQYEALKFVSFPTQVLAKASKVIPVMLMGKLVSRRSYEHWEY
LTATLISIGVSMFLLSSGPEPRSSPATTLSGLILLAGYIAFDSFTSNWQDALFAYKMSSV
QMMFGVNFFSCLFTVGSLLEQGALLEGTRFMGRHSEFAAHALLLSICSACGQLFIFYTIG
QFGAAVFTIIMTLRQAFAILLSCLLYGHTVTVVGGLGVAVVFAALLLRVYARGRLKQRGK
KAVPVESPVQKV

Sequence length

432

Interactions

View interactions

	Reactome
			Transport and synthesis of PAPS Transport of nucleotide sugars

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Leukodystrophy, hypomyelinating, 26, with chondrodysplasia	Pathogenic	rs757164153, rs760851221	RCV003152568 RCV003152620	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Primary bone dysplasia with multiple joint dislocations	Pathogenic	rs760851221	RCV001264615	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Hypomyelinating leukodystrophy 11	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Treacher Collins syndrome 3	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (27)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	20809502		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	25124574		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	25124574	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	25124574	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	25124574		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	11342346, 12454822, 1376056, 16109617, 25700432, 8946198, 9888704		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	27756247	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Multiple Exostoses	Multiple congenital exostosis	BEFREE	21506131		★★★★★ ★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	25124574		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	31187468		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	25962811, 27008888, 29793519, 31554637		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	22851516, 27008888		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	BEFREE	27370174		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	BEFREE	22706868		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	25124574		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	1376056		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	10627471, 11986399, 21344225, 22706868, 22944294, 28109040, 31638169		★★★★★ ★☆☆☆☆ Found in Text Mining only
Marginal Zone B-Cell Lymphoma	B-Cell Lymphoma	BEFREE	27008888		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	35798875	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Merkel cell carcinoma	Merkel cell carcinoma	BEFREE	24610800		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mixed Cellularity Hodgkin Lymphoma	Classical Hodgkin lymphoma	BEFREE	14703693		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucosa-Associated Lymphoid Tissue Lymphoma	Mucosa-associated lymphoma	BEFREE	27008888		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11078802, 19926586, 22235315, 28407516		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	25962811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Reticulosarcoma	Reticulosarcoma	BEFREE	19926586		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Lymphocytic Lymphoma	Lymphocytic Leukemia	BEFREE	11342346, 12454822, 16109617, 8946198		★★★★★ ★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom`s Macroglobulinemia	BEFREE	11342346		★★★★★ ★☆☆☆☆ Found in Text Mining only

SLC35B2 (solute carrier family 35 member B2)