CATSPER3 (cation channel sperm associated 3)

Gene

• Entrez ID: 347732
• Gene name: Cation channel sperm associated 3
• Gene symbol: CATSPER3
• Synonyms (NCBI Gene): CACRC
• Chromosome: 5
• Chromosome location: 5q31.1

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT864479	hsa-miR-3649	CLIP-seq
MIRT864480	hsa-miR-4527	CLIP-seq
MIRT864481	hsa-miR-492	CLIP-seq
MIRT864482	hsa-miR-633	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001669	Component	Acrosomal vesicle	IBA
GO:0001669	Component	Acrosomal vesicle	IEA
GO:0005216	Function	Monoatomic ion channel activity	IEA
GO:0005245	Function	Voltage-gated calcium channel activity	IBA
GO:0005245	Function	Voltage-gated calcium channel activity	IEA
GO:0005245	Function	Voltage-gated calcium channel activity	ISS
GO:0005262	Function	Calcium channel activity	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005929	Component	Cilium	IEA
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006814	Process	Sodium ion transport	IBA
GO:0006814	Process	Sodium ion transport	IEA
GO:0006814	Process	Sodium ion transport	ISS
GO:0006816	Process	Calcium ion transport	IEA
GO:0007283	Process	Spermatogenesis	IEA
GO:0016020	Component	Membrane	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030317	Process	Flagellated sperm motility	IBA
GO:0030317	Process	Flagellated sperm motility	IEA
GO:0031514	Component	Motile cilium	IEA
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0034702	Component	Monoatomic ion channel complex	IEA
GO:0036128	Component	CatSper complex	IBA
GO:0036128	Component	CatSper complex	IEA
GO:0036128	Component	CatSper complex	ISS
GO:0042995	Component	Cell projection	IEA
GO:0048240	Process	Sperm capacitation	IBA
GO:0048240	Process	Sperm capacitation	IEA
GO:0051649	Process	Establishment of localization in cell	IEA
GO:0055085	Process	Transmembrane transport	IEA
GO:0070588	Process	Calcium ion transmembrane transport	IEA

Other IDs

• MIM: 609120
• HGNC: 20819
• e!Ensembl: ENSG00000152705

Protein

• UniProt ID: Q86XQ3
• Protein name: Cation channel sperm-associated protein 3 (CatSper3) (Ca(v)-like protein) (One-repeat calcium channel-like protein)
• Protein function: Pore-forming subunit of the CatSper complex, a sperm-specific voltage-gated calcium channel that plays a central role in calcium-dependent physiological responses essential for successful fertilization, such as sperm hyperactivation, acrosome re
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00520	Ion_trans	49 → 276	Ion transport protein	Family

• Tissue specificity: TISSUE SPECIFICITY: Testis-specific. {ECO:0000269|PubMed:12646162, ECO:0000269|PubMed:12932298, ECO:0000269|PubMed:17347248}.
• Sequence:

  MSQHRHQRHSRVISSSPVDTTSVGFCPTFKKFKRNDDECRAFVKRVIMSRFFKIIMISTV
  TSNAFFMALWTSYDIRYRLFRLLEFSEIFFVSICTSELSMKVYVDPINYWKNGYNLLDVI
  IIIVMFLPYALRQLMGKQFTYLYIADGMQSLRILKLIGYSQGIRTLITAVGQTVYTVASV
  LLLLFLLMYIFAILGFCLFGSPDNGDHDNWGNLAAAFFTLFSLATVDGWTDLQKQLDNRE
  FALSRAFTIIFILLASFIFLNMFVGVMIMHTEDSIRKFERELMLEQQEMLMGEKQVILQR
  QQEEISRLMHIQKNADCTSFSELVENFKKTLSHTDPMVLDDFGTSLPFIDIYFSTLDYQD
  TTVHKLQELYYEIVHVLSLMLEDLPQEKPQSLEKVDEK

• Sequence length: 398

Pathways

Reactome:

Sperm Motility And Taxes

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ATRIAL FIBRILLATION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BULIMIA NERVOSA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ROTATOR CUFF TEAR	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Asthma	Asthma	Pubtator	35606283	Associate	★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	33350607	Associate	★☆☆☆☆ Found in Text Mining only