Gene Gene information from NCBI Gene database.
Entrez ID 347730
Gene name Leucine rich repeat transmembrane neuronal 1
Gene symbol LRRTM1
Synonyms (NCBI Gene)
-
Chromosome 2
Chromosome location 2p12
miRNA miRNA information provided by mirtarbase database.
10
miRTarBase ID miRNA Experiments Reference
MIRT021433 hsa-miR-9-5p Microarray 17612493
MIRT1121062 hsa-miR-1263 CLIP-seq
MIRT1121063 hsa-miR-3613-3p CLIP-seq
MIRT1121064 hsa-miR-509-3p CLIP-seq
MIRT1121065 hsa-miR-520d-5p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
24
GO ID Ontology Definition Evidence Reference
GO:0002091 Process Negative regulation of receptor internalization IEA
GO:0005783 Component Endoplasmic reticulum IDA 17667961
GO:0005886 Component Plasma membrane IBA
GO:0005886 Component Plasma membrane IEA
GO:0007626 Process Locomotory behavior IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
610867 19408 ENSG00000162951
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q86UE6
Protein name Leucine-rich repeat transmembrane neuronal protein 1
Protein function Exhibits strong synaptogenic activity, restricted to excitatory presynaptic differentiation, acting at both pre- and postsynaptic level.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13855 LRR_8 113 173 Leucine rich repeat Repeat
PF13855 LRR_8 161 221 Leucine rich repeat Repeat
PF13855 LRR_8 256 315 Leucine rich repeat Repeat
Tissue specificity TISSUE SPECIFICITY: Predominantly expressed in forebrain regions including thalamus and cerebral cortex. {ECO:0000269|PubMed:12676565, ECO:0000269|PubMed:17667961}.
Sequence
MDFLLLGLCLYWLLRRPSGVVLCLLGACFQMLPAAPSGCPQLCRCEGRLLYCEALNLTEA
PHNLSGLLGLSLRYNSLSELRAGQFTGLMQLTWLYLDHNHICSVQGDAFQKLRRVKELTL
SSNQITQLPNTTFRPMPNLRSVDLSYNKLQALAPDLFHGL
RKLTTLHMRANAIQFVPVRI
FQDCRSLKFLDIGYNQLKSLARNSFAGLFKLTELHLEHNDL
VKVNFAHFPRLISLHSLCL
RRNKVAIVVSSLDWVWNLEKMDLSGNEIEYMEPHVFETVPHLQSLQLDSNRLTYIEPRIL
NSWKSLTSITLAGNL
WDCGRNVCALASWLNNFQGRYDGNLQCASPEYAQGEDVLDAVYAF
HLCEDGAEPTSGHLLSAVTNRSDLGPPASSATTLADGGEGQHDGTFEPATVALPGGEHAE
NAVQIHKVVTGTMALIFSFLIVVLVLYVSWKCFPASLRQLRQCFVTQRRKQKQKQTMHQM
AAMSAQEYYVDYKPNHIEGALVIINEYGSCTCHQQPARECEV
Sequence length 522
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Neurexins and neuroligins
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
SCHIZOPHRENIA Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Graves Ophthalmopathy Graves ophthalmopathy Pubtator 36056316 Associate
★☆☆☆☆
Found in Text Mining only
Neurodevelopmental Disorders Neurodevelopmental Disorders BEFREE 17667961
★☆☆☆☆
Found in Text Mining only
Nonorganic psychosis Nonorganic Psychosis BEFREE 19125366
★☆☆☆☆
Found in Text Mining only
Psychotic Disorders Psychosis BEFREE 19125366
★☆☆☆☆
Found in Text Mining only
Schizophrenia Schizophrenia BEFREE 17667961, 19125367, 24785688, 25111784
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Schizophrenia Schizophrenia LHGDN 17667961
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Schizophrenia Schizophrenia PSYGENET_DG 17667961, 25111784
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Squamous Cell Carcinoma of Head and Neck Squamous cell carcinoma Pubtator 28814981 Associate
★☆☆☆☆
Found in Text Mining only