Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	3476
Gene name	Immunoglobulin binding protein 1
Gene symbol	IGBP1
Synonyms (NCBI Gene)	ALPHA-4IBP1MRXS28alpha4
Chromosome	X
Chromosome location	Xq13.1
Summary	The proliferation and differentiation of B cells is dependent upon a B-cell antigen receptor (BCR) complex. Binding of antigens to specific B-cell receptors results in a tyrosine phosphorylation reaction through the BCR complex and leads to multiple signa

146

Show/Hide all (146)

miRTarBase ID	miRNA	Experiments	Reference
MIRT529584	hsa-miR-34b-3p	PAR-CLIP	20371350
MIRT529583	hsa-miR-8485	PAR-CLIP	20371350
MIRT529582	hsa-miR-329-3p	PAR-CLIP	20371350
MIRT529581	hsa-miR-362-3p	PAR-CLIP	20371350
MIRT529580	hsa-miR-603	PAR-CLIP	20371350
MIRT529578	hsa-miR-216b-3p	PAR-CLIP	20371350
MIRT529577	hsa-miR-3614-5p	PAR-CLIP	20371350
MIRT529576	hsa-miR-6500-3p	PAR-CLIP	20371350
MIRT529575	hsa-miR-3117-5p	PAR-CLIP	20371350
MIRT529574	hsa-miR-3941	PAR-CLIP	20371350
MIRT529573	hsa-miR-514a-3p	PAR-CLIP	20371350
MIRT529572	hsa-miR-514b-3p	PAR-CLIP	20371350
MIRT529584	hsa-miR-34b-3p	PAR-CLIP	22012620
MIRT529583	hsa-miR-8485	PAR-CLIP	22012620
MIRT529582	hsa-miR-329-3p	PAR-CLIP	22012620
MIRT529581	hsa-miR-362-3p	PAR-CLIP	22012620
MIRT529580	hsa-miR-603	PAR-CLIP	22012620
MIRT529579	hsa-miR-4724-5p	PAR-CLIP	22012620
MIRT529578	hsa-miR-216b-3p	PAR-CLIP	22012620
MIRT529577	hsa-miR-3614-5p	PAR-CLIP	22012620
MIRT529576	hsa-miR-6500-3p	PAR-CLIP	22012620
MIRT529575	hsa-miR-3117-5p	PAR-CLIP	22012620
MIRT529574	hsa-miR-3941	PAR-CLIP	22012620
MIRT529573	hsa-miR-514a-3p	PAR-CLIP	22012620
MIRT529572	hsa-miR-514b-3p	PAR-CLIP	22012620
MIRT529574	hsa-miR-3941	Luciferase reporter assayqRT-PCRWestern blot	28012229
MIRT529574	hsa-miR-3941	Luciferase reporter assayqRT-PCRWestern blot	28012229
MIRT529574	hsa-miR-3941	Luciferase reporter assayqRT-PCRWestern blot	28012229
MIRT529574	hsa-miR-3941	Luciferase reporter assayqRT-PCRWestern blot	28012229
MIRT529584	hsa-miR-34b-3p	Luciferase reporter assayqRT-PCRWestern blot	28012229
MIRT529584	hsa-miR-34b-3p	Luciferase reporter assayqRT-PCRWestern blot	28012229
MIRT529584	hsa-miR-34b-3p	Luciferase reporter assayqRT-PCRWestern blot	28012229
MIRT529574	hsa-miR-3941	Luciferase reporter assayqRT-PCRWestern blot	28012229
MIRT529574	hsa-miR-3941	Luciferase reporter assayqRT-PCRWestern blot	28012229
MIRT529584	hsa-miR-34b-3p	PAR-CLIP	20371350
MIRT529583	hsa-miR-8485	PAR-CLIP	20371350
MIRT529582	hsa-miR-329-3p	PAR-CLIP	20371350
MIRT529581	hsa-miR-362-3p	PAR-CLIP	20371350
MIRT529580	hsa-miR-603	PAR-CLIP	20371350
MIRT529578	hsa-miR-216b-3p	PAR-CLIP	20371350
MIRT529577	hsa-miR-3614-5p	PAR-CLIP	20371350
MIRT529576	hsa-miR-6500-3p	PAR-CLIP	20371350
MIRT529575	hsa-miR-3117-5p	PAR-CLIP	20371350
MIRT529574	hsa-miR-3941	PAR-CLIP	20371350
MIRT529573	hsa-miR-514a-3p	PAR-CLIP	20371350
MIRT529572	hsa-miR-514b-3p	PAR-CLIP	20371350
MIRT529584	hsa-miR-34b-3p	PAR-CLIP	22012620
MIRT529583	hsa-miR-8485	PAR-CLIP	22012620
MIRT529582	hsa-miR-329-3p	PAR-CLIP	22012620
MIRT529581	hsa-miR-362-3p	PAR-CLIP	22012620
MIRT529580	hsa-miR-603	PAR-CLIP	22012620
MIRT529579	hsa-miR-4724-5p	PAR-CLIP	22012620
MIRT529578	hsa-miR-216b-3p	PAR-CLIP	22012620
MIRT529577	hsa-miR-3614-5p	PAR-CLIP	22012620
MIRT529576	hsa-miR-6500-3p	PAR-CLIP	22012620
MIRT529575	hsa-miR-3117-5p	PAR-CLIP	22012620
MIRT529574	hsa-miR-3941	PAR-CLIP	22012620
MIRT529573	hsa-miR-514a-3p	PAR-CLIP	22012620
MIRT529572	hsa-miR-514b-3p	PAR-CLIP	22012620
MIRT1061164	hsa-miR-4789-5p	CLIP-seq
MIRT1061165	hsa-miR-4797-5p	CLIP-seq
MIRT2246489	hsa-miR-1914	CLIP-seq
MIRT2246490	hsa-miR-4265	CLIP-seq
MIRT2246491	hsa-miR-4296	CLIP-seq
MIRT2246492	hsa-miR-4322	CLIP-seq
MIRT2246493	hsa-miR-4648	CLIP-seq
MIRT2246494	hsa-miR-4654	CLIP-seq
MIRT2246495	hsa-miR-4694-5p	CLIP-seq
MIRT2246496	hsa-miR-4747-5p	CLIP-seq
MIRT2246497	hsa-miR-4769-5p	CLIP-seq
MIRT2550047	hsa-miR-1207-5p	CLIP-seq
MIRT2550048	hsa-miR-1288	CLIP-seq
MIRT2550049	hsa-miR-1321	CLIP-seq
MIRT2550050	hsa-miR-1909	CLIP-seq
MIRT2550051	hsa-miR-1910	CLIP-seq
MIRT2246489	hsa-miR-1914	CLIP-seq
MIRT2550052	hsa-miR-217	CLIP-seq
MIRT2550053	hsa-miR-3157-3p	CLIP-seq
MIRT2550054	hsa-miR-3160-3p	CLIP-seq
MIRT2550055	hsa-miR-3169	CLIP-seq
MIRT2550056	hsa-miR-3189-3p	CLIP-seq
MIRT2550057	hsa-miR-330-3p	CLIP-seq
MIRT2550058	hsa-miR-3613-5p	CLIP-seq
MIRT2550059	hsa-miR-3620	CLIP-seq
MIRT2246490	hsa-miR-4265	CLIP-seq
MIRT2550060	hsa-miR-4270	CLIP-seq
MIRT2550061	hsa-miR-4290	CLIP-seq
MIRT2246491	hsa-miR-4296	CLIP-seq
MIRT2246492	hsa-miR-4322	CLIP-seq
MIRT2550062	hsa-miR-4441	CLIP-seq
MIRT2550063	hsa-miR-451b	CLIP-seq
MIRT2246493	hsa-miR-4648	CLIP-seq
MIRT2246494	hsa-miR-4654	CLIP-seq
MIRT2550064	hsa-miR-4655-3p	CLIP-seq
MIRT2246495	hsa-miR-4694-5p	CLIP-seq
MIRT2550065	hsa-miR-4722-5p	CLIP-seq
MIRT2550066	hsa-miR-4728-5p	CLIP-seq
MIRT2550067	hsa-miR-4736	CLIP-seq
MIRT2550068	hsa-miR-4739	CLIP-seq
MIRT2246496	hsa-miR-4747-5p	CLIP-seq
MIRT2550069	hsa-miR-4756-5p	CLIP-seq
MIRT2550070	hsa-miR-4763-3p	CLIP-seq
MIRT2550071	hsa-miR-4768-3p	CLIP-seq
MIRT2246497	hsa-miR-4769-5p	CLIP-seq
MIRT2550072	hsa-miR-4786-5p	CLIP-seq
MIRT1061165	hsa-miR-4797-5p	CLIP-seq
MIRT2550073	hsa-miR-502-5p	CLIP-seq
MIRT2550074	hsa-miR-518a-5p	CLIP-seq
MIRT2550075	hsa-miR-527	CLIP-seq
MIRT2550076	hsa-miR-874	CLIP-seq
MIRT2550047	hsa-miR-1207-5p	CLIP-seq
MIRT2550048	hsa-miR-1288	CLIP-seq
MIRT2550049	hsa-miR-1321	CLIP-seq
MIRT2550050	hsa-miR-1909	CLIP-seq
MIRT2550051	hsa-miR-1910	CLIP-seq
MIRT2246489	hsa-miR-1914	CLIP-seq
MIRT2550052	hsa-miR-217	CLIP-seq
MIRT2550053	hsa-miR-3157-3p	CLIP-seq
MIRT2550054	hsa-miR-3160-3p	CLIP-seq
MIRT2550055	hsa-miR-3169	CLIP-seq
MIRT2550056	hsa-miR-3189-3p	CLIP-seq
MIRT2550057	hsa-miR-330-3p	CLIP-seq
MIRT2550058	hsa-miR-3613-5p	CLIP-seq
MIRT2550059	hsa-miR-3620	CLIP-seq
MIRT2246490	hsa-miR-4265	CLIP-seq
MIRT2550060	hsa-miR-4270	CLIP-seq
MIRT2550061	hsa-miR-4290	CLIP-seq
MIRT2246491	hsa-miR-4296	CLIP-seq
MIRT2246492	hsa-miR-4322	CLIP-seq
MIRT2550062	hsa-miR-4441	CLIP-seq
MIRT2550063	hsa-miR-451b	CLIP-seq
MIRT2550064	hsa-miR-4655-3p	CLIP-seq
MIRT2246495	hsa-miR-4694-5p	CLIP-seq
MIRT2550065	hsa-miR-4722-5p	CLIP-seq
MIRT2550066	hsa-miR-4728-5p	CLIP-seq
MIRT2550067	hsa-miR-4736	CLIP-seq
MIRT2550068	hsa-miR-4739	CLIP-seq
MIRT2550069	hsa-miR-4756-5p	CLIP-seq
MIRT2550070	hsa-miR-4763-3p	CLIP-seq
MIRT2550071	hsa-miR-4768-3p	CLIP-seq
MIRT2550072	hsa-miR-4786-5p	CLIP-seq
MIRT1061165	hsa-miR-4797-5p	CLIP-seq
MIRT2550073	hsa-miR-502-5p	CLIP-seq
MIRT2550074	hsa-miR-518a-5p	CLIP-seq
MIRT2550075	hsa-miR-527	CLIP-seq
MIRT2550076	hsa-miR-874	CLIP-seq

Show/Hide all (16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	17438131
GO:0005515	Function	Protein binding	IPI	9647778, 16085932, 16769727, 18186651, 18614045, 18715871, 18782753, 19156129, 21988832, 23892082, 24255178, 25277244, 26496610, 27880917, 28330616, 32296183, 32814053, 33961781, 35271311
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	NAS	9647778
GO:0005829	Component	Cytosol	IBA
GO:0007165	Process	Signal transduction	NAS	9647778
GO:0009966	Process	Regulation of signal transduction	IEA
GO:0019888	Function	Protein phosphatase regulator activity	IDA	9647778
GO:0032873	Process	Negative regulation of stress-activated MAPK cascade	IMP	17438131
GO:0034612	Process	Response to tumor necrosis factor	IMP	17438131
GO:0035303	Process	Regulation of dephosphorylation	IBA
GO:0035556	Process	Intracellular signal transduction	IMP	17438131
GO:0042113	Process	B cell activation	IEA
GO:0051721	Function	Protein phosphatase 2A binding	IBA
GO:0060632	Process	Regulation of microtubule-based movement	IMP	18949047
GO:0070555	Process	Response to interleukin-1	IMP	17438131

MIM	HGNC	e!Ensembl
300139	5461	ENSG00000089289

P78318

Protein name

Immunoglobulin-binding protein 1 (B-cell signal transduction molecule alpha 4) (Protein alpha-4) (CD79a-binding protein 1) (Protein phosphatase 2/4/6 regulatory subunit) (Renal carcinoma antigen NY-REN-16)

Protein function

Associated to surface IgM-receptor; may be involved in signal transduction. Involved in regulation of the catalytic activity of the phosphatases PP2A, PP4 and PP6 by protecting their partially folded catalytic subunits from degradative polyubiqu

PDB

4IYP

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04177	TAP42	12 → 329	TAP42-like family	Family

Tissue specificity

TISSUE SPECIFICITY: Ubiquitously expressed with highest levels in heart, skeletal muscle and pancreas.

Sequence

MAAEDELQLPRLPELFETGRQLLDEVEVATEPAGSRIVQEKVFKGLDLLEKAAEMLSQLD
LFSRNEDLEEIASTDLKYLLVPAFQGALTMKQVNPSKRLDHLQRAREHFINYLTQCHCYH
VAEFELPKTMNNSAENHTANSSMAYPSLVAMASQRQAKIQRYKQKKELEHRLSAMKSAVE
SGQADDERVREYYLLHLQRWIDISLEEIESIDQEIKILRERDSSREASTSNSSRQERPPV
KPFILTRNMAQAKVFGAGYPSLPTMTVSDWYEQHRKYGALPDQGIAKAAPEEFRKAAQQQ
EEQEEKEEEDDEQTLHRAREWDDWKDTHPRGYGNRQNMG

Sequence length

339

Interactions

View interactions

	KEGG
	Autophagy - other Autophagy - animal

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Corpus callosum agenesis-intellectual disability-coloboma-micrognathia syndrome	Pathogenic	rs2147562704	RCV000012329	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BREAST NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORPUS CALLOSUM, AGENESIS OF, WITH IMPAIRED INTELLECTUAL DEVELOPMENT, OCULAR COLOBOMA, AND MICROGNATHIA	—	HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORPUS CALLOSUM, AGENESIS OF, WITH MENTAL RETARDATION, OCULAR COLOBOMA, AND MICROGNATHIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IGBP1-related disorder	Uncertain significance; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (43)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	28012229		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	28012229		★★★★★ ★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Alport Syndrome	Alport Syndrome	BEFREE	14524583		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autosomal Dominant Nocturnal Frontal Lobe Epilepsy	Nocturnal Epilepsy	BEFREE	10563623, 10643924, 19237585		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	21339737		★★★★★ ★☆☆☆☆ Found in Text Mining only
Byzanthine arch palate	High palate	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Choanal Atresia	Choanal Atresia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	19655168		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coloboma of optic disc	Coloboma of optic disc	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital coloboma of iris	Congenital Coloboma Of Iris	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital pectus excavatum	Congenital Pectus Excavatum	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Corpus callosum agenesis-intellectual disability-coloboma-micrognathia syndrome	Corpus Callosum Agenesis-Intellectual Disability-Coloboma-Micrognathia Syndrome	Orphanet			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Corpus Callosum, Agenesis of, with Mental Retardation, Ocular Coloboma, and Micrognathia	Corpus Callosum, Agenesis, With Mental Retardation, Ocular Coloboma, And Micrognathia	GENOMICS_ENGLAND_DG	14556245		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Corpus Callosum, Agenesis of, with Mental Retardation, Ocular Coloboma, and Micrognathia	Corpus Callosum, Agenesis, With Mental Retardation, Ocular Coloboma, And Micrognathia	ORPHANET_DG	14556245		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Corpus Callosum, Agenesis of, with Mental Retardation, Ocular Coloboma, and Micrognathia	Corpus Callosum, Agenesis, With Mental Retardation, Ocular Coloboma, And Micrognathia	CTD_human_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dwarfism	Dwarfism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	31875416	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
FG syndrome	FG Syndrome	BEFREE	12203739		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematuria, Benign Familial	Hematuria	BEFREE	14524583, 8787673		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	23871722	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	21339737		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	CTD_human_DG	21339737		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	31137925		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	31137925		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	31137925	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	24357726	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Macrocephaly	Macrocephaly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	21339737		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG	21339737		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	21339737		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	21339737		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	21339737		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	31137925		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nystagmus	Nystagmus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Opitz GBBB Syndrome, X-Linked	Opitz GBBB Syndrome, X-Linked	BEFREE	12203739		★★★★★ ★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Scoliosis, unspecified	Scoliosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Seasonal Affective Disorder	Seasonal Affective Disorder	BEFREE	14614915		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sensorineural Hearing Loss (disorder)	Hearing Loss	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	18697202		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular Septal Defects	Ventricular septal defect	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only

IGBP1 (immunoglobulin binding protein 1)