IGFBPL1 (insulin like growth factor binding protein like 1)

Gene

• Entrez ID: 347252
• Gene name: Insulin like growth factor binding protein like 1
• Gene symbol: IGFBPL1
• Synonyms (NCBI Gene): IGFBP-RP4, IGFBPRP4, bA113O24.1
• Chromosome: 9
• Chromosome location: 9p13.1

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT019447	hsa-miR-148b-3p	Microarray	17612493

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001558	Process	Regulation of cell growth	IEA
GO:0005520	Function	Insulin-like growth factor binding	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	15845387
GO:0009966	Process	Regulation of signal transduction	IBA
GO:0031012	Component	Extracellular matrix	IBA
GO:0071228	Process	Cellular response to tumor cell	IEP	15845387

Other IDs

• MIM: 610413
• HGNC: 20081
• e!Ensembl: ENSG00000137142

Protein

• UniProt ID: Q8WX77
• Protein name: Insulin-like growth factor-binding protein-like 1 (IGFBP-related protein 10) (Insulin-like growth factor-binding-related protein 4) (IGFBP-rP4)
• Protein function: IGF-binding proteins prolong the half-life of IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs in cell culture. They alter the interaction of IGFs with their cell surface receptors (By similarity).
• PDB: 7MJ6, 7MJ7, 7MJ8, 7MJ9
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00219	IGFBP	38 → 91	Insulin-like growth factor binding protein	Domain
  PF07648	Kazal_2	104 → 151	Kazal-type serine protease inhibitor domain	Domain
  PF07679	I-set	155 → 260	Immunoglobulin I-set domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed at the highest level in both brain and testis, with lower levels in the prostate, bladder and lung. {ECO:0000269|PubMed:15845387}.
• Sequence:

  MPRLSLLLPLLLLLLLPLLPPLSPSLGIRDVGGRRPKCGPCRPEGCPAPAPCPAPGISAL
  DECGCCARCLGAEGASCGGRAGGRCGPGLVCASQAAGAAPEGTGLCVCAQRGTVCGSDGR
  SYPSVCALRLRARHTPRAHPGHLHKARDGPCEFAPVVVVPPRSVHNVTGAQVGLSCEVRA
  VPTPVITWRKVTKSPEGTQALEELPGDHVNIAVQVRGGPSDHEATAWILINPLRKEDEGV
  YQCHAANMVGEAESHSTVTVLDLSKYRSFHFPAPDDRM

• Sequence length: 278

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
LARGE ARTERY STROKE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE MYELOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Atherosclerosis	Atherosclerosis	Pubtator	38157252	Inhibit	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	17634530		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	17634530		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	34061869	Associate	★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	25836355		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	33607293	Associate	★☆☆☆☆ Found in Text Mining only
Growth Disorders	Growth disorder	Pubtator	27178284	Associate	★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	25836355		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	17634530		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	17634530		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	17634530		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	25836355		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	27762626	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	36211409	Associate	★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	25836355		★☆☆☆☆ Found in Text Mining only