APOC4 (apolipoprotein C4)

Gene

• Entrez ID: 346
• Gene name: Apolipoprotein C4
• Gene symbol: APOC4
• Synonyms (NCBI Gene): APO-CIV, APOC-IV
• Chromosome: 19
• Chromosome location: 19q13.32
• Summary: This gene encodes a lipid-binding protein belonging to the apolipoprotein gene family. The protein is thought to play a role in lipid metabolism. Polymorphisms in this gene may influence circulating lipid levels and may be associated with coronary artery

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1933044	hsa-miR-1200	CLIP-seq
MIRT1933045	hsa-miR-3199	CLIP-seq
MIRT1933046	hsa-miR-4258	CLIP-seq
MIRT1933047	hsa-miR-4269	CLIP-seq
MIRT1933048	hsa-miR-4324	CLIP-seq
MIRT1933049	hsa-miR-4438	CLIP-seq
MIRT1933050	hsa-miR-4777-3p	CLIP-seq
MIRT1933051	hsa-miR-5095	CLIP-seq
MIRT1933052	hsa-miR-544b	CLIP-seq
MIRT2173229	hsa-miR-3663-5p	CLIP-seq
MIRT2173230	hsa-miR-4423-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005319	Function	Lipid transporter activity	TAS	8530039
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0006629	Process	Lipid metabolic process	TAS	8530039
GO:0006869	Process	Lipid transport	IEA
GO:0019915	Process	Lipid storage	IMP	18809223
GO:0034361	Component	Very-low-density lipoprotein particle	IBA
GO:0034361	Component	Very-low-density lipoprotein particle	IDA	12700345, 17154273
GO:0034361	Component	Very-low-density lipoprotein particle	IEA
GO:0034361	Component	Very-low-density lipoprotein particle	IMP	8827523
GO:0034364	Component	High-density lipoprotein particle	IBA
GO:0034364	Component	High-density lipoprotein particle	IDA	12700345
GO:0070328	Process	Triglyceride homeostasis	IBA
GO:0070328	Process	Triglyceride homeostasis	IMP	8827523

Other IDs

• MIM: 600745
• HGNC: 611
• e!Ensembl: ENSG00000267467

Protein

• UniProt ID: P55056
• Protein name: Apolipoprotein C-IV (Apo-CIV) (ApoC-IV) (Apolipoprotein C4)
• Protein function: May participate in lipoprotein metabolism.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15119	APOC4	31 → 124	Apolipoprotein C4	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed by the liver and secreted in plasma.
• Sequence:

  MSLLRNRLQALPALCLCVLVLACIGACQPEAQEGTLSPPPKLKMSRWSLVRGRMKELLET
  VVNRTRDGWQWFWSPSTFRGFMQTYYDDHLRDLGPLTKAWFLESKDSLLKKTHSLCPRLV
  CGDKDQG

• Sequence length: 127

Pathways

Reactome:

VLDL assembly
VLDL clearance
NR1H3 & NR1H2 regulate gene expression linked to cholesterol transport and efflux

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROESOPHAGEAL REFLUX DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Alzheimer Disease	Alzheimer disease	Pubtator	39201500	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Alzheimer`s Disease	Alzheimer disease	GWASCAT_DG	29777097		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	28160560	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	26129832		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	26129832, 39201500	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	20498921		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	25470794		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	18809223		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	18809223	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	31211449		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	11812765		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	31047001		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	18809223		★☆☆☆☆ Found in Text Mining only