PAQR9 (progestin and adipoQ receptor family member 9)

Gene

• Entrez ID: 344838
• Gene name: Progestin and adipoQ receptor family member 9
• Gene symbol: PAQR9
• Synonyms (NCBI Gene): BLNC1
• Chromosome: 3
• Chromosome location: 3q23

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT2455882	hsa-miR-146a	CLIP-seq
MIRT2455883	hsa-miR-146b-5p	CLIP-seq
MIRT2455884	hsa-miR-3653	CLIP-seq
MIRT2455885	hsa-miR-3658	CLIP-seq
MIRT2455886	hsa-miR-4461	CLIP-seq
MIRT2455887	hsa-miR-4680-5p	CLIP-seq
MIRT2455888	hsa-miR-548a-5p	CLIP-seq
MIRT2455889	hsa-miR-548ab	CLIP-seq
MIRT2455890	hsa-miR-548ak	CLIP-seq
MIRT2455891	hsa-miR-548b-5p	CLIP-seq
MIRT2455892	hsa-miR-548c-5p	CLIP-seq
MIRT2455893	hsa-miR-548d-5p	CLIP-seq
MIRT2455894	hsa-miR-548h	CLIP-seq
MIRT2455895	hsa-miR-548i	CLIP-seq
MIRT2455896	hsa-miR-548j	CLIP-seq
MIRT2455897	hsa-miR-548w	CLIP-seq
MIRT2455898	hsa-miR-548y	CLIP-seq
MIRT2455899	hsa-miR-559	CLIP-seq
MIRT2455900	hsa-miR-580	CLIP-seq
MIRT2455901	hsa-miR-589	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005496	Function	Steroid binding	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0008289	Function	Lipid binding	IEA
GO:0016020	Component	Membrane	IEA
GO:0038023	Function	Signaling receptor activity	IBA

Other IDs

• MIM: 614580
• HGNC: 30131
• e!Ensembl: ENSG00000188582

Protein

• UniProt ID: Q6ZVX9
• Protein name: Membrane progestin receptor epsilon (mPR epsilon) (Membrane progesterone P4 receptor epsilon) (Membrane progesterone receptor epsilon) (Progesterone and adipoQ receptor family member 9) (Progestin and adipoQ receptor family member 9) (Progestin and adipoQ
• Protein function: Plasma membrane progesterone (P4) receptor coupled to G proteins (PubMed:23161870, PubMed:23763432). Seems to act through a G(s) mediated pathway (PubMed:23161870). May be involved in regulating rapid P4 signaling in the nervous system (PubMed:2
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF03006	HlyIII	78 → 326	Haemolysin-III related	Family

• Tissue specificity: TISSUE SPECIFICITY: Expression levels vary widely in a range of tissues (PubMed:16044242). Expressed in the brain, at high level in the pituitary gland and also in hypothalamus, limbic system, caudate nucleus accumens, pons and olfactory bulb (PubMed:2316
• Sequence:

  MPRRLQPRGAGTKGPPAPAPAASGAARNSHSAASRDPPASAKPLLRWDEVPDDFVECFIL
  SGYRRLPCTAQECLASVLKPTNETLNFWTHFIPLLLFLSKFCRLFFLSGGDVPFHHPWLL
  PLWCYASGVLLTFAMSCTAHVFSCLSLRLRAAFFYLDYASISYYGFGSTVAYYYYLLPGL
  SLLDARVMTPYLQQRLGWHVDCTRLIAAYRALVLPVAFVLAVACTVACCKSRTDWCTYPF
  ALRTFVFVMPLSMACPIMLESWLFDLRGENPTLFVHFYRRYFWLVVAAFFNVSKIPERIQ
  PGLFDIIGHSHQLFHIFTFLSIYDQVYYVEEGLRQFLQAPPAAPTFSGTVGYMLLLVVCL
  GLVIRKFLNSSEFCSKK

• Sequence length: 377

Pathways

KEGG:

Neuroactive ligand-receptor interaction

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Breast Neoplasms	Breast neoplasm	Pubtator	23161870	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	35240821	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	32077034	Associate	★☆☆☆☆ Found in Text Mining only