Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	344558
Gene name	SH3 domain containing ring finger 3
Gene symbol	SH3RF3
Synonyms (NCBI Gene)	POSH2SH3MD4
Chromosome	2
Chromosome location	2q13

105

Show/Hide all (105)

miRTarBase ID	miRNA	Experiments
MIRT1345640	hsa-miR-1264	CLIP-seq
MIRT1345641	hsa-miR-1266	CLIP-seq
MIRT1345642	hsa-miR-1321	CLIP-seq
MIRT1345643	hsa-miR-3134	CLIP-seq
MIRT1345644	hsa-miR-3153	CLIP-seq
MIRT1345645	hsa-miR-3163	CLIP-seq
MIRT1345646	hsa-miR-3183	CLIP-seq
MIRT1345647	hsa-miR-338-3p	CLIP-seq
MIRT1345648	hsa-miR-4270	CLIP-seq
MIRT1345649	hsa-miR-4282	CLIP-seq
MIRT1345650	hsa-miR-4286	CLIP-seq
MIRT1345651	hsa-miR-4441	CLIP-seq
MIRT1345652	hsa-miR-4469	CLIP-seq
MIRT1345653	hsa-miR-4518	CLIP-seq
MIRT1345654	hsa-miR-4534	CLIP-seq
MIRT1345655	hsa-miR-4659a-3p	CLIP-seq
MIRT1345656	hsa-miR-4659b-3p	CLIP-seq
MIRT1345657	hsa-miR-4668-5p	CLIP-seq
MIRT1345658	hsa-miR-4698	CLIP-seq
MIRT1345659	hsa-miR-4723-3p	CLIP-seq
MIRT1345660	hsa-miR-4739	CLIP-seq
MIRT1345661	hsa-miR-4756-5p	CLIP-seq
MIRT1345662	hsa-miR-4758-3p	CLIP-seq
MIRT1345663	hsa-miR-4775	CLIP-seq
MIRT1345664	hsa-miR-510	CLIP-seq
MIRT1345665	hsa-miR-548c-3p	CLIP-seq
MIRT1345666	hsa-miR-642a	CLIP-seq
MIRT1553675	hsa-miR-1915	CLIP-seq
MIRT1553676	hsa-miR-3937	CLIP-seq
MIRT1553677	hsa-miR-4726-3p	CLIP-seq
MIRT2102259	hsa-miR-1236	CLIP-seq
MIRT2102260	hsa-miR-18a	CLIP-seq
MIRT2102261	hsa-miR-18b	CLIP-seq
MIRT1553675	hsa-miR-1915	CLIP-seq
MIRT2102262	hsa-miR-3160-5p	CLIP-seq
MIRT1345646	hsa-miR-3183	CLIP-seq
MIRT1553676	hsa-miR-3937	CLIP-seq
MIRT1345659	hsa-miR-4723-3p	CLIP-seq
MIRT1553677	hsa-miR-4726-3p	CLIP-seq
MIRT2102263	hsa-miR-4735-3p	CLIP-seq
MIRT2102264	hsa-miR-4761-5p	CLIP-seq
MIRT1345641	hsa-miR-1266	CLIP-seq
MIRT2326792	hsa-miR-181a	CLIP-seq
MIRT2326793	hsa-miR-181b	CLIP-seq
MIRT2326794	hsa-miR-181c	CLIP-seq
MIRT2326795	hsa-miR-181d	CLIP-seq
MIRT1553675	hsa-miR-1915	CLIP-seq
MIRT2102262	hsa-miR-3160-5p	CLIP-seq
MIRT1345646	hsa-miR-3183	CLIP-seq
MIRT1553676	hsa-miR-3937	CLIP-seq
MIRT2326796	hsa-miR-4262	CLIP-seq
MIRT1345648	hsa-miR-4270	CLIP-seq
MIRT1345650	hsa-miR-4286	CLIP-seq
MIRT2326797	hsa-miR-4323	CLIP-seq
MIRT1345651	hsa-miR-4441	CLIP-seq
MIRT1345653	hsa-miR-4518	CLIP-seq
MIRT2326798	hsa-miR-4633-3p	CLIP-seq
MIRT2326799	hsa-miR-4690-3p	CLIP-seq
MIRT1345659	hsa-miR-4723-3p	CLIP-seq
MIRT1553677	hsa-miR-4726-3p	CLIP-seq
MIRT1345662	hsa-miR-4758-3p	CLIP-seq
MIRT2326800	hsa-miR-490-3p	CLIP-seq
MIRT1345664	hsa-miR-510	CLIP-seq
MIRT2394406	hsa-miR-124	CLIP-seq
MIRT2394407	hsa-miR-3122	CLIP-seq
MIRT2394408	hsa-miR-3622a-5p	CLIP-seq
MIRT2394409	hsa-miR-3689a-3p	CLIP-seq
MIRT2394410	hsa-miR-3689c	CLIP-seq
MIRT2394411	hsa-miR-3913-5p	CLIP-seq
MIRT2394412	hsa-miR-4434	CLIP-seq
MIRT2394413	hsa-miR-4516	CLIP-seq
MIRT2394414	hsa-miR-506	CLIP-seq
MIRT1345642	hsa-miR-1321	CLIP-seq
MIRT2622292	hsa-miR-320a	CLIP-seq
MIRT2622293	hsa-miR-320b	CLIP-seq
MIRT2622294	hsa-miR-320c	CLIP-seq
MIRT2622295	hsa-miR-320d	CLIP-seq
MIRT2622296	hsa-miR-330-3p	CLIP-seq
MIRT1345647	hsa-miR-338-3p	CLIP-seq
MIRT1345648	hsa-miR-4270	CLIP-seq
MIRT2622297	hsa-miR-4429	CLIP-seq
MIRT1345651	hsa-miR-4441	CLIP-seq
MIRT1345660	hsa-miR-4739	CLIP-seq
MIRT1345661	hsa-miR-4756-5p	CLIP-seq
MIRT2690684	hsa-miR-1270	CLIP-seq
MIRT1345642	hsa-miR-1321	CLIP-seq
MIRT2622292	hsa-miR-320a	CLIP-seq
MIRT2622293	hsa-miR-320b	CLIP-seq
MIRT2622294	hsa-miR-320c	CLIP-seq
MIRT2622295	hsa-miR-320d	CLIP-seq
MIRT2622296	hsa-miR-330-3p	CLIP-seq
MIRT1345647	hsa-miR-338-3p	CLIP-seq
MIRT2690685	hsa-miR-3617	CLIP-seq
MIRT2690686	hsa-miR-3913-3p	CLIP-seq
MIRT1345648	hsa-miR-4270	CLIP-seq
MIRT2622297	hsa-miR-4429	CLIP-seq
MIRT1345651	hsa-miR-4441	CLIP-seq
MIRT2690687	hsa-miR-4683	CLIP-seq
MIRT2690688	hsa-miR-4691-5p	CLIP-seq
MIRT1345660	hsa-miR-4739	CLIP-seq
MIRT1345661	hsa-miR-4756-5p	CLIP-seq
MIRT2690689	hsa-miR-4802-3p	CLIP-seq
MIRT2690690	hsa-miR-489	CLIP-seq
MIRT2690691	hsa-miR-620	CLIP-seq
MIRT2690692	hsa-miR-641	CLIP-seq

Show/Hide all (14)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	16374509, 20696164
GO:0008270	Function	Zinc ion binding	IEA
GO:0016567	Process	Protein ubiquitination	IBA
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0032436	Process	Positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IBA
GO:0046330	Process	Positive regulation of JNK cascade	IBA
GO:0046330	Process	Positive regulation of JNK cascade	IMP	20696164
GO:0046872	Function	Metal ion binding	IEA
GO:0051865	Process	Protein autoubiquitination	IEA
GO:0051865	Process	Protein autoubiquitination	IMP	20696164
GO:0061630	Function	Ubiquitin protein ligase activity	IBA
GO:0061630	Function	Ubiquitin protein ligase activity	IEA
GO:0061630	Function	Ubiquitin protein ligase activity	IMP	20696164

MIM	HGNC	e!Ensembl
618933	24699	ENSG00000172985

Q8TEJ3

Protein name

E3 ubiquitin-protein ligase SH3RF3 (EC 2.3.2.27) (Plenty of SH3s 2) (SH3 domain-containing RING finger protein 3) (SH3 multiple domains protein 4)

Protein function

Has E3 ubiquitin-protein ligase activity.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00097	zf-C3HC4	57 → 97	Zinc finger, C3HC4 type (RING finger)	Domain
PF00018	SH3_1	200 → 245	SH3 domain	Domain
PF00018	SH3_1	262 → 311	SH3 domain	Domain
PF14604	SH3_9	471 → 521	Variant SH3 domain	Domain
PF14604	SH3_9	830 → 880	Variant SH3 domain	Domain

Sequence

MLLGASWLCASKAAAAAAQSEGDEDRPGERRRRRAAATAAGAGEDMDESSLLDLLECSVC
LERLDTTAKVLPCQHTFCRRCLESIVCSRHELRCPECRILVGCGVDELPANILLVRLLDG
IRQRPRAGTSPGGSPPARPIPGQSAAPTLAGGGGGAAGSTPGSPVFLSAAAGSTAGSLRE
LATSRTAPAAKNPCLLPYGKALYSYEGKEPGDLKFNKGDIIVLRRKVDEQWYHGELHGTQ
GFLPASYIQCIQPLPHAPPQGKALYDFEMKDKDQDKDCLTFTKDEILTVLRRVDENWAEG
MLGDKIGIFPLLYVELNDSAKQLIEMDKPCPAAASSCNASLPSDSGAVASVAPSPTLSSS
GAVSAFQRRVDGKKNTKKRHSFTALSVTHRSSQAASHRHSMEISAPVLISSSDPRAAARI
GDLAHLSCAAPTQDVSSSAGSTPTAVPRAASVSGEQGTPPKVQLPLNVYLALYAYKPQKS
DELELHKGEMYRVLEKCQDGWFKGASLRTGVSGVFPGNYVTPVSRVPAGGAGPPRNNVVG
GSPLAKGITTTMHPGSGSLSSLATATRPALPITTPQAHAQHPTASPPTGSCLRHSAQPTA
SQARSTISTAAHSAAQAQDRPTATVSPLRTQNSPSRLPATSLRPHSVVSPQHSHQPPVQM
CPRPAIPLTSAASAITPPNVSAANLNGEAGGGPIGVLSTSSPTNTGCKLDEKKSEKKEKK
SGLLKLLAGASTKKKSRSPPSVSPTHDPQVAVDALLQGAVGPEVSSLSIHGRAGSCPIES
EMQGAMGMEPLHRKAGSLDLNFTSPSRQAPLSMAAIRPEPKLLPRERYRVVVSYPPQSEA
EIELKEGDIVFVHKKREDGWYKGTLQRNGRTGLFPGSFVESF

Sequence length

882

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (8)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMPHETAMINE OR RELATED ACTING SYMPATHOMIMETIC ABUSE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMPHETAMINE-RELATED DISORDERS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTROCYTOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (7)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Breast Neoplasms	Breast neoplasm	Pubtator	32427938	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	37813278	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	37420130	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leukemia	Leukemia	Pubtator	26001296	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	36495291	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	34486645	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

SH3RF3 (SH3 domain containing ring finger 3)