Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	3437
Gene name	Interferon induced protein with tetratricopeptide repeats 3
Gene symbol	IFIT3
Synonyms (NCBI Gene)	CIG-49GARG-49IFI60IFIT4IRG2ISG60P60RIG-Gcig41
Chromosome	10
Chromosome location	10q23.31

382

Show/Hide all (382)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021277	hsa-miR-146a-5p	Microarray	18057241
MIRT022687	hsa-miR-124-3p	Microarray	18668037
MIRT023767	hsa-miR-1-3p	Microarray	18668037
MIRT040680	hsa-miR-92b-3p	CLASH	23622248
MIRT684351	hsa-miR-4438	HITS-CLIP	23313552
MIRT684350	hsa-miR-512-3p	HITS-CLIP	23313552
MIRT684349	hsa-miR-6504-3p	HITS-CLIP	23313552
MIRT684348	hsa-miR-3613-3p	HITS-CLIP	23313552
MIRT684347	hsa-miR-1273g-3p	HITS-CLIP	23313552
MIRT684346	hsa-miR-619-5p	HITS-CLIP	23313552
MIRT684345	hsa-miR-6506-5p	HITS-CLIP	23313552
MIRT684344	hsa-miR-4252	HITS-CLIP	23313552
MIRT684343	hsa-miR-4731-5p	HITS-CLIP	23313552
MIRT684342	hsa-miR-5589-5p	HITS-CLIP	23313552
MIRT684341	hsa-miR-3926	HITS-CLIP	23313552
MIRT684340	hsa-miR-5095	HITS-CLIP	23313552
MIRT684339	hsa-miR-7151-3p	HITS-CLIP	23313552
MIRT684338	hsa-miR-6807-5p	HITS-CLIP	23313552
MIRT684337	hsa-miR-5089-5p	HITS-CLIP	23313552
MIRT613945	hsa-miR-570-3p	HITS-CLIP	23824327
MIRT736279	hsa-miR-143-3p	Microarray	32093694
MIRT684351	hsa-miR-4438	HITS-CLIP	23313552
MIRT684350	hsa-miR-512-3p	HITS-CLIP	23313552
MIRT684349	hsa-miR-6504-3p	HITS-CLIP	23313552
MIRT684348	hsa-miR-3613-3p	HITS-CLIP	23313552
MIRT684347	hsa-miR-1273g-3p	HITS-CLIP	23313552
MIRT684346	hsa-miR-619-5p	HITS-CLIP	23313552
MIRT684345	hsa-miR-6506-5p	HITS-CLIP	23313552
MIRT684344	hsa-miR-4252	HITS-CLIP	23313552
MIRT684343	hsa-miR-4731-5p	HITS-CLIP	23313552
MIRT684342	hsa-miR-5589-5p	HITS-CLIP	23313552
MIRT684341	hsa-miR-3926	HITS-CLIP	23313552
MIRT684340	hsa-miR-5095	HITS-CLIP	23313552
MIRT684339	hsa-miR-7151-3p	HITS-CLIP	23313552
MIRT684338	hsa-miR-6807-5p	HITS-CLIP	23313552
MIRT684337	hsa-miR-5089-5p	HITS-CLIP	23313552
MIRT613945	hsa-miR-570-3p	HITS-CLIP	23824327
MIRT1060337	hsa-miR-122	CLIP-seq
MIRT1060338	hsa-miR-1267	CLIP-seq
MIRT1060339	hsa-miR-1273f	CLIP-seq
MIRT1060340	hsa-miR-1289	CLIP-seq
MIRT1060341	hsa-miR-129-5p	CLIP-seq
MIRT1060342	hsa-miR-143	CLIP-seq
MIRT1060343	hsa-miR-1909	CLIP-seq
MIRT1060344	hsa-miR-3135b	CLIP-seq
MIRT1060345	hsa-miR-3180-5p	CLIP-seq
MIRT1060346	hsa-miR-3194-3p	CLIP-seq
MIRT1060347	hsa-miR-3198	CLIP-seq
MIRT1060348	hsa-miR-3652	CLIP-seq
MIRT1060349	hsa-miR-3667-3p	CLIP-seq
MIRT1060350	hsa-miR-4279	CLIP-seq
MIRT1060351	hsa-miR-4294	CLIP-seq
MIRT1060352	hsa-miR-4309	CLIP-seq
MIRT1060353	hsa-miR-431	CLIP-seq
MIRT1060354	hsa-miR-4423-5p	CLIP-seq
MIRT1060355	hsa-miR-4430	CLIP-seq
MIRT1060356	hsa-miR-4534	CLIP-seq
MIRT1060357	hsa-miR-4708-5p	CLIP-seq
MIRT1060358	hsa-miR-4770	CLIP-seq
MIRT1060359	hsa-miR-520a-5p	CLIP-seq
MIRT1060360	hsa-miR-525-5p	CLIP-seq
MIRT1060361	hsa-miR-924	CLIP-seq
MIRT1060362	hsa-miR-106a	CLIP-seq
MIRT1060363	hsa-miR-106b	CLIP-seq
MIRT1060364	hsa-miR-1224-3p	CLIP-seq
MIRT1060365	hsa-miR-1234	CLIP-seq
MIRT1060366	hsa-miR-150	CLIP-seq
MIRT1060367	hsa-miR-17	CLIP-seq
MIRT1060368	hsa-miR-20a	CLIP-seq
MIRT1060369	hsa-miR-20b	CLIP-seq
MIRT1060370	hsa-miR-302a	CLIP-seq
MIRT1060371	hsa-miR-302b	CLIP-seq
MIRT1060372	hsa-miR-302c	CLIP-seq
MIRT1060373	hsa-miR-302d	CLIP-seq
MIRT1060374	hsa-miR-302e	CLIP-seq
MIRT1060375	hsa-miR-372	CLIP-seq
MIRT1060376	hsa-miR-373	CLIP-seq
MIRT1060377	hsa-miR-4454	CLIP-seq
MIRT1060378	hsa-miR-519d	CLIP-seq
MIRT1060379	hsa-miR-520a-3p	CLIP-seq
MIRT1060380	hsa-miR-520b	CLIP-seq
MIRT1060381	hsa-miR-520c-3p	CLIP-seq
MIRT1060382	hsa-miR-520d-3p	CLIP-seq
MIRT1060383	hsa-miR-520e	CLIP-seq
MIRT1060384	hsa-miR-520g	CLIP-seq
MIRT1060385	hsa-miR-520h	CLIP-seq
MIRT1060386	hsa-miR-93	CLIP-seq
MIRT1921646	hsa-miR-100	CLIP-seq
MIRT1921647	hsa-miR-99a	CLIP-seq
MIRT1921648	hsa-miR-99b	CLIP-seq
MIRT1921646	hsa-miR-100	CLIP-seq
MIRT1921647	hsa-miR-99a	CLIP-seq
MIRT1921648	hsa-miR-99b	CLIP-seq
MIRT1921646	hsa-miR-100	CLIP-seq
MIRT1921647	hsa-miR-99a	CLIP-seq
MIRT1921648	hsa-miR-99b	CLIP-seq
MIRT1060337	hsa-miR-122	CLIP-seq
MIRT1060338	hsa-miR-1267	CLIP-seq
MIRT1060339	hsa-miR-1273f	CLIP-seq
MIRT1060340	hsa-miR-1289	CLIP-seq
MIRT1060341	hsa-miR-129-5p	CLIP-seq
MIRT1060342	hsa-miR-143	CLIP-seq
MIRT1060366	hsa-miR-150	CLIP-seq
MIRT2014114	hsa-miR-1976	CLIP-seq
MIRT1060344	hsa-miR-3135b	CLIP-seq
MIRT1060346	hsa-miR-3194-3p	CLIP-seq
MIRT1060347	hsa-miR-3198	CLIP-seq
MIRT2014115	hsa-miR-3199	CLIP-seq
MIRT1060348	hsa-miR-3652	CLIP-seq
MIRT1060349	hsa-miR-3667-3p	CLIP-seq
MIRT1060350	hsa-miR-4279	CLIP-seq
MIRT1060351	hsa-miR-4294	CLIP-seq
MIRT1060352	hsa-miR-4309	CLIP-seq
MIRT1060353	hsa-miR-431	CLIP-seq
MIRT1060354	hsa-miR-4423-5p	CLIP-seq
MIRT1060355	hsa-miR-4430	CLIP-seq
MIRT1060356	hsa-miR-4534	CLIP-seq
MIRT1060357	hsa-miR-4708-5p	CLIP-seq
MIRT2014116	hsa-miR-4722-3p	CLIP-seq
MIRT1060358	hsa-miR-4770	CLIP-seq
MIRT2014117	hsa-miR-552	CLIP-seq
MIRT2014118	hsa-miR-562	CLIP-seq
MIRT1060361	hsa-miR-924	CLIP-seq
MIRT1060354	hsa-miR-4423-5p	CLIP-seq
MIRT1060362	hsa-miR-106a	CLIP-seq
MIRT1060363	hsa-miR-106b	CLIP-seq
MIRT1060337	hsa-miR-122	CLIP-seq
MIRT1060364	hsa-miR-1224-3p	CLIP-seq
MIRT1060365	hsa-miR-1234	CLIP-seq
MIRT1060338	hsa-miR-1267	CLIP-seq
MIRT1060339	hsa-miR-1273f	CLIP-seq
MIRT1060340	hsa-miR-1289	CLIP-seq
MIRT1060342	hsa-miR-143	CLIP-seq
MIRT1060366	hsa-miR-150	CLIP-seq
MIRT1060367	hsa-miR-17	CLIP-seq
MIRT1060343	hsa-miR-1909	CLIP-seq
MIRT1060368	hsa-miR-20a	CLIP-seq
MIRT1060369	hsa-miR-20b	CLIP-seq
MIRT1060370	hsa-miR-302a	CLIP-seq
MIRT1060371	hsa-miR-302b	CLIP-seq
MIRT1060372	hsa-miR-302c	CLIP-seq
MIRT1060373	hsa-miR-302d	CLIP-seq
MIRT1060374	hsa-miR-302e	CLIP-seq
MIRT1060344	hsa-miR-3135b	CLIP-seq
MIRT1060346	hsa-miR-3194-3p	CLIP-seq
MIRT1060347	hsa-miR-3198	CLIP-seq
MIRT1060348	hsa-miR-3652	CLIP-seq
MIRT1060375	hsa-miR-372	CLIP-seq
MIRT1060376	hsa-miR-373	CLIP-seq
MIRT1060351	hsa-miR-4294	CLIP-seq
MIRT1060352	hsa-miR-4309	CLIP-seq
MIRT1060353	hsa-miR-431	CLIP-seq
MIRT1060354	hsa-miR-4423-5p	CLIP-seq
MIRT1060355	hsa-miR-4430	CLIP-seq
MIRT1060377	hsa-miR-4454	CLIP-seq
MIRT1060356	hsa-miR-4534	CLIP-seq
MIRT1060357	hsa-miR-4708-5p	CLIP-seq
MIRT1060358	hsa-miR-4770	CLIP-seq
MIRT1060378	hsa-miR-519d	CLIP-seq
MIRT1060379	hsa-miR-520a-3p	CLIP-seq
MIRT1060380	hsa-miR-520b	CLIP-seq
MIRT1060381	hsa-miR-520c-3p	CLIP-seq
MIRT1060382	hsa-miR-520d-3p	CLIP-seq
MIRT1060383	hsa-miR-520e	CLIP-seq
MIRT1060384	hsa-miR-520g	CLIP-seq
MIRT1060385	hsa-miR-520h	CLIP-seq
MIRT1060361	hsa-miR-924	CLIP-seq
MIRT1060386	hsa-miR-93	CLIP-seq
MIRT1060341	hsa-miR-129-5p	CLIP-seq
MIRT2451605	hsa-miR-3149	CLIP-seq
MIRT2451606	hsa-miR-3167	CLIP-seq
MIRT2451607	hsa-miR-411	CLIP-seq
MIRT2451608	hsa-miR-4735-5p	CLIP-seq
MIRT2451609	hsa-miR-4775	CLIP-seq
MIRT2451610	hsa-miR-4794	CLIP-seq
MIRT2451611	hsa-miR-483-5p	CLIP-seq
MIRT2451612	hsa-miR-590-3p	CLIP-seq
MIRT2451613	hsa-miR-876-5p	CLIP-seq
MIRT2014115	hsa-miR-3199	CLIP-seq
MIRT1921646	hsa-miR-100	CLIP-seq
MIRT1060362	hsa-miR-106a	CLIP-seq
MIRT1060363	hsa-miR-106b	CLIP-seq
MIRT2549679	hsa-miR-1193	CLIP-seq
MIRT2549680	hsa-miR-1202	CLIP-seq
MIRT2549681	hsa-miR-1207-5p	CLIP-seq
MIRT2549682	hsa-miR-1208	CLIP-seq
MIRT1060364	hsa-miR-1224-3p	CLIP-seq
MIRT1060365	hsa-miR-1234	CLIP-seq
MIRT2549683	hsa-miR-1236	CLIP-seq
MIRT1060341	hsa-miR-129-5p	CLIP-seq
MIRT2549684	hsa-miR-1321	CLIP-seq
MIRT2549685	hsa-miR-137	CLIP-seq
MIRT2549686	hsa-miR-146a	CLIP-seq
MIRT2549687	hsa-miR-146b-5p	CLIP-seq
MIRT1060366	hsa-miR-150	CLIP-seq
MIRT1060367	hsa-miR-17	CLIP-seq
MIRT2549688	hsa-miR-1915	CLIP-seq
MIRT2014114	hsa-miR-1976	CLIP-seq
MIRT1060368	hsa-miR-20a	CLIP-seq
MIRT1060369	hsa-miR-20b	CLIP-seq
MIRT2549689	hsa-miR-2278	CLIP-seq
MIRT2549690	hsa-miR-2392	CLIP-seq
MIRT2549691	hsa-miR-2861	CLIP-seq
MIRT2549692	hsa-miR-296-5p	CLIP-seq
MIRT2549693	hsa-miR-299-3p	CLIP-seq
MIRT1060370	hsa-miR-302a	CLIP-seq
MIRT1060371	hsa-miR-302b	CLIP-seq
MIRT1060372	hsa-miR-302c	CLIP-seq
MIRT1060373	hsa-miR-302d	CLIP-seq
MIRT1060374	hsa-miR-302e	CLIP-seq
MIRT2549694	hsa-miR-3129-3p	CLIP-seq
MIRT2451605	hsa-miR-3149	CLIP-seq
MIRT2549695	hsa-miR-3152-3p	CLIP-seq
MIRT2451606	hsa-miR-3167	CLIP-seq
MIRT2549696	hsa-miR-3194-5p	CLIP-seq
MIRT2014115	hsa-miR-3199	CLIP-seq
MIRT2549697	hsa-miR-323-5p	CLIP-seq
MIRT2549698	hsa-miR-339-5p	CLIP-seq
MIRT2549699	hsa-miR-3607-5p	CLIP-seq
MIRT2549700	hsa-miR-3616-3p	CLIP-seq
MIRT1060349	hsa-miR-3667-3p	CLIP-seq
MIRT2549701	hsa-miR-3667-5p	CLIP-seq
MIRT2549702	hsa-miR-371-5p	CLIP-seq
MIRT2549703	hsa-miR-371b-5p	CLIP-seq
MIRT1060375	hsa-miR-372	CLIP-seq
MIRT1060376	hsa-miR-373	CLIP-seq
MIRT2549704	hsa-miR-380	CLIP-seq
MIRT2549705	hsa-miR-3972	CLIP-seq
MIRT2451607	hsa-miR-411	CLIP-seq
MIRT2549706	hsa-miR-4251	CLIP-seq
MIRT2549707	hsa-miR-4260	CLIP-seq
MIRT2549708	hsa-miR-4265	CLIP-seq
MIRT2549709	hsa-miR-4270	CLIP-seq
MIRT1060350	hsa-miR-4279	CLIP-seq
MIRT2549710	hsa-miR-4296	CLIP-seq
MIRT2549711	hsa-miR-4310	CLIP-seq
MIRT2549712	hsa-miR-4313	CLIP-seq
MIRT2549713	hsa-miR-4322	CLIP-seq
MIRT2549714	hsa-miR-4417	CLIP-seq
MIRT2549715	hsa-miR-4420	CLIP-seq
MIRT2549716	hsa-miR-4421	CLIP-seq
MIRT2549717	hsa-miR-4436b-3p	CLIP-seq
MIRT2549718	hsa-miR-4441	CLIP-seq
MIRT1060377	hsa-miR-4454	CLIP-seq
MIRT2549719	hsa-miR-4495	CLIP-seq
MIRT2549720	hsa-miR-4662a-5p	CLIP-seq
MIRT2549721	hsa-miR-4676-5p	CLIP-seq
MIRT2549722	hsa-miR-4691-3p	CLIP-seq
MIRT2014116	hsa-miR-4722-3p	CLIP-seq
MIRT2549723	hsa-miR-4725-5p	CLIP-seq
MIRT2549724	hsa-miR-4726-3p	CLIP-seq
MIRT2549725	hsa-miR-4728-5p	CLIP-seq
MIRT2549726	hsa-miR-4729	CLIP-seq
MIRT2451608	hsa-miR-4735-5p	CLIP-seq
MIRT2549727	hsa-miR-4736	CLIP-seq
MIRT2549728	hsa-miR-4739	CLIP-seq
MIRT2549729	hsa-miR-4756-5p	CLIP-seq
MIRT2549730	hsa-miR-4763-3p	CLIP-seq
MIRT2451609	hsa-miR-4775	CLIP-seq
MIRT2549731	hsa-miR-4790-3p	CLIP-seq
MIRT2451610	hsa-miR-4794	CLIP-seq
MIRT2451611	hsa-miR-483-5p	CLIP-seq
MIRT2549732	hsa-miR-504	CLIP-seq
MIRT2549733	hsa-miR-508-5p	CLIP-seq
MIRT2549734	hsa-miR-518a-5p	CLIP-seq
MIRT1060378	hsa-miR-519d	CLIP-seq
MIRT1060379	hsa-miR-520a-3p	CLIP-seq
MIRT1060380	hsa-miR-520b	CLIP-seq
MIRT1060381	hsa-miR-520c-3p	CLIP-seq
MIRT1060382	hsa-miR-520d-3p	CLIP-seq
MIRT1060383	hsa-miR-520e	CLIP-seq
MIRT1060384	hsa-miR-520g	CLIP-seq
MIRT1060385	hsa-miR-520h	CLIP-seq
MIRT2549735	hsa-miR-527	CLIP-seq
MIRT2549736	hsa-miR-539	CLIP-seq
MIRT2549737	hsa-miR-545	CLIP-seq
MIRT2549738	hsa-miR-548a-3p	CLIP-seq
MIRT2549739	hsa-miR-548c-3p	CLIP-seq
MIRT2549740	hsa-miR-548e	CLIP-seq
MIRT2549741	hsa-miR-548f	CLIP-seq
MIRT2014118	hsa-miR-562	CLIP-seq
MIRT2549742	hsa-miR-570	CLIP-seq
MIRT2549743	hsa-miR-575	CLIP-seq
MIRT2549744	hsa-miR-589	CLIP-seq
MIRT2451612	hsa-miR-590-3p	CLIP-seq
MIRT2549745	hsa-miR-670	CLIP-seq
MIRT2549746	hsa-miR-767-3p	CLIP-seq
MIRT2549747	hsa-miR-876-3p	CLIP-seq
MIRT2451613	hsa-miR-876-5p	CLIP-seq
MIRT2549748	hsa-miR-892a	CLIP-seq
MIRT1060386	hsa-miR-93	CLIP-seq
MIRT1921647	hsa-miR-99a	CLIP-seq
MIRT1921648	hsa-miR-99b	CLIP-seq
MIRT1060362	hsa-miR-106a	CLIP-seq
MIRT1060363	hsa-miR-106b	CLIP-seq
MIRT2549679	hsa-miR-1193	CLIP-seq
MIRT2549682	hsa-miR-1208	CLIP-seq
MIRT1060364	hsa-miR-1224-3p	CLIP-seq
MIRT1060365	hsa-miR-1234	CLIP-seq
MIRT2549683	hsa-miR-1236	CLIP-seq
MIRT1060341	hsa-miR-129-5p	CLIP-seq
MIRT2549685	hsa-miR-137	CLIP-seq
MIRT2549686	hsa-miR-146a	CLIP-seq
MIRT2549687	hsa-miR-146b-5p	CLIP-seq
MIRT1060366	hsa-miR-150	CLIP-seq
MIRT1060367	hsa-miR-17	CLIP-seq
MIRT2549688	hsa-miR-1915	CLIP-seq
MIRT2014114	hsa-miR-1976	CLIP-seq
MIRT1060368	hsa-miR-20a	CLIP-seq
MIRT1060369	hsa-miR-20b	CLIP-seq
MIRT2549689	hsa-miR-2278	CLIP-seq
MIRT2549690	hsa-miR-2392	CLIP-seq
MIRT2549691	hsa-miR-2861	CLIP-seq
MIRT2549692	hsa-miR-296-5p	CLIP-seq
MIRT2549693	hsa-miR-299-3p	CLIP-seq
MIRT1060370	hsa-miR-302a	CLIP-seq
MIRT1060371	hsa-miR-302b	CLIP-seq
MIRT1060372	hsa-miR-302c	CLIP-seq
MIRT1060373	hsa-miR-302d	CLIP-seq
MIRT1060374	hsa-miR-302e	CLIP-seq
MIRT2549694	hsa-miR-3129-3p	CLIP-seq
MIRT2451605	hsa-miR-3149	CLIP-seq
MIRT2549695	hsa-miR-3152-3p	CLIP-seq
MIRT2451606	hsa-miR-3167	CLIP-seq
MIRT2014115	hsa-miR-3199	CLIP-seq
MIRT2549698	hsa-miR-339-5p	CLIP-seq
MIRT2549699	hsa-miR-3607-5p	CLIP-seq
MIRT1060349	hsa-miR-3667-3p	CLIP-seq
MIRT2549701	hsa-miR-3667-5p	CLIP-seq
MIRT2549702	hsa-miR-371-5p	CLIP-seq
MIRT2549703	hsa-miR-371b-5p	CLIP-seq
MIRT1060375	hsa-miR-372	CLIP-seq
MIRT1060376	hsa-miR-373	CLIP-seq
MIRT2549704	hsa-miR-380	CLIP-seq
MIRT2451607	hsa-miR-411	CLIP-seq
MIRT2549707	hsa-miR-4260	CLIP-seq
MIRT2549708	hsa-miR-4265	CLIP-seq
MIRT1060350	hsa-miR-4279	CLIP-seq
MIRT2549710	hsa-miR-4296	CLIP-seq
MIRT2549711	hsa-miR-4310	CLIP-seq
MIRT2549712	hsa-miR-4313	CLIP-seq
MIRT2549713	hsa-miR-4322	CLIP-seq
MIRT2549714	hsa-miR-4417	CLIP-seq
MIRT2549715	hsa-miR-4420	CLIP-seq
MIRT2549716	hsa-miR-4421	CLIP-seq
MIRT1060377	hsa-miR-4454	CLIP-seq
MIRT2549719	hsa-miR-4495	CLIP-seq
MIRT2549720	hsa-miR-4662a-5p	CLIP-seq
MIRT2549721	hsa-miR-4676-5p	CLIP-seq
MIRT2549722	hsa-miR-4691-3p	CLIP-seq
MIRT2014116	hsa-miR-4722-3p	CLIP-seq
MIRT2549724	hsa-miR-4726-3p	CLIP-seq
MIRT2549726	hsa-miR-4729	CLIP-seq
MIRT2451608	hsa-miR-4735-5p	CLIP-seq
MIRT2451609	hsa-miR-4775	CLIP-seq
MIRT2451610	hsa-miR-4794	CLIP-seq
MIRT2451611	hsa-miR-483-5p	CLIP-seq
MIRT2549733	hsa-miR-508-5p	CLIP-seq
MIRT2549734	hsa-miR-518a-5p	CLIP-seq
MIRT1060378	hsa-miR-519d	CLIP-seq
MIRT1060379	hsa-miR-520a-3p	CLIP-seq
MIRT1060380	hsa-miR-520b	CLIP-seq
MIRT1060381	hsa-miR-520c-3p	CLIP-seq
MIRT1060382	hsa-miR-520d-3p	CLIP-seq
MIRT1060383	hsa-miR-520e	CLIP-seq
MIRT1060384	hsa-miR-520g	CLIP-seq
MIRT1060385	hsa-miR-520h	CLIP-seq
MIRT2549735	hsa-miR-527	CLIP-seq
MIRT2549736	hsa-miR-539	CLIP-seq
MIRT2549737	hsa-miR-545	CLIP-seq
MIRT2549739	hsa-miR-548c-3p	CLIP-seq
MIRT2014118	hsa-miR-562	CLIP-seq
MIRT2549742	hsa-miR-570	CLIP-seq
MIRT2549743	hsa-miR-575	CLIP-seq
MIRT2549744	hsa-miR-589	CLIP-seq
MIRT2451612	hsa-miR-590-3p	CLIP-seq
MIRT2549745	hsa-miR-670	CLIP-seq
MIRT2549746	hsa-miR-767-3p	CLIP-seq
MIRT2451613	hsa-miR-876-5p	CLIP-seq
MIRT2549748	hsa-miR-892a	CLIP-seq
MIRT1060386	hsa-miR-93	CLIP-seq
MIRT2014115	hsa-miR-3199	CLIP-seq

Show/Hide all (5)

Transcription factor	Regulation	Reference
IRF1	Activation	21056555
IRF9	Unknown	19351818;20403236
SPI1	Activation	21176776
STAT1	Unknown	17050680
STAT2	Unknown	19351818;20403236

Show/Hide all (17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002376	Process	Immune system process	IEA
GO:0005515	Function	Protein binding	IPI	16189514, 17050680, 21163940, 21190939, 21516116, 21642987, 21813773, 25416956, 25910212, 27107012, 28514442, 30833792, 31515488, 32296183, 33961781
GO:0005737	Component	Cytoplasm	IDA	17050680, 18706081
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IDA	21813773
GO:0005739	Component	Mitochondrion	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0008285	Process	Negative regulation of cell population proliferation	IDA	17050680
GO:0009615	Process	Response to virus	IMP	21642987
GO:0042802	Function	Identical protein binding	IPI	16189514, 21163940, 21642987
GO:0043066	Process	Negative regulation of apoptotic process	IDA	21190939
GO:0045087	Process	Innate immune response	IEA
GO:0051607	Process	Defense response to virus	IBA
GO:0051607	Process	Defense response to virus	IEA
GO:0140374	Process	Antiviral innate immune response	IDA	21642987

MIM	HGNC	e!Ensembl
604650	5411	ENSG00000119917

O14879

Protein name

Interferon-induced protein with tetratricopeptide repeats 3 (IFIT-3) (CIG49) (ISG-60) (Interferon-induced 60 kDa protein) (IFI-60K) (Interferon-induced protein with tetratricopeptide repeats 4) (IFIT-4) (Retinoic acid-induced gene G protein) (P60) (RIG-G)

Protein function

IFN-induced antiviral protein which acts as an inhibitor of cellular as well as viral processes, cell migration, proliferation, signaling, and viral replication. Enhances MAVS-mediated host antiviral responses by serving as an adapter bridging T

PDB

6C6K

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13424	TPR_12	49 → 126		Repeat
PF13181	TPR_8	140 → 169	Tetratricopeptide repeat	Repeat
PF13176	TPR_7	243 → 275	Tetratricopeptide repeat	Repeat
PF13181	TPR_8	415 → 442	Tetratricopeptide repeat	Repeat

Tissue specificity

TISSUE SPECIFICITY: Expression significantly higher in peripheral blood mononuclear cells (PBMCs) and monocytes from systemic lupus erythematosus (SLE) patients than in those from healthy individuals (at protein level). Spleen, lung, leukocytes, lymph nod

Sequence

MSEVTKNSLEKILPQLKCHFTWNLFKEDSVSRDLEDRVCNQIEFLNTEFKATMYNLLAYI
KHLDGNNEAALECLRQAEELIQQEHADQAEIRSLVTWGNYAWVYYHLGRLSDAQIYVDKV
KQTCKKFSNPYSIEYSELDCEEGWTQLKCGRNERAKVCFEKALEEKPNNPEFSSGLAIAM
YHLDNHPEKQFSTDVLKQAIELSPDNQYVKVLLGLKLQKMNKEAEGEQFVEEALEKSPCQ
TDVLRSAAKFYRRKGDLDKAIELFQRVLESTPNNGYLYHQIGCCYKAKVRQMQNTGESEA
SGNKEMIEALKQYAMDYSNKALEKGLNPLNAYSDLAEFLETECYQTPFNKEVPDAEKQQS
HQRYCNLQKYNGKSEDTAVQHGLEGLSISKKSTDKEEIKDQPQNVSENLLPQNAPNYWYL
QGLIHKQNGDLLQAAKCYEKELGRLLRDAPSGIGSIFLSASELEDGSEEMGQGAVSSSPR
ELLSNSEQLN

Sequence length

490

Interactions

View interactions

	Reactome
			Interferon alpha/beta signaling

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CONGESTIVE HEART FAILURE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (75)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	28356064		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alternating hemiplegia of childhood	Alternating hemiplegia of childhood	Pubtator	26769142	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	36841839	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	29434723		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	28210844		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	34079550, 36189314, 36524113	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	36437453	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	18706081		★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	36226612	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	29103029, 29552132, 29986702		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	38129382	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Lewis Lung	Lewis lung carcinoma	Pubtator	32741018	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	32641986	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	28150292	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	8390539		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	35593226	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	38200280	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cyclic neutropenia	Cyclic neutropenia	Pubtator	18706081	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystitis	Cystitis	BEFREE	23273104		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystitis Interstitial	Interstitial cystitis	Pubtator	37925174	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	37118825, 37353938	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatomyositis, Childhood Type	Dermatomyositis	BEFREE	21670437		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	35655479	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	35655479	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Angiopathies	Diabetic cardiomyopathy	BEFREE	10997688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	8660983, 8792829		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	29301256	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	36007277	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	36071497	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hereditary hemochromatosis	Hereditary Hemochromatosis	BEFREE	31178742		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	26489762	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	24763552	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic cardiomyopathy	Ischemic myocardial dysfunction	BEFREE	28150292		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	29285302		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	21176776, 34356051	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	28471454		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	37980495	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	17050680, 32741018, 34356051, 9207104	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukomalacia, Periventricular	Periventricular Leukomalacia	BEFREE	28406931		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	18706081		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	28295457		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	32741018	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Cutaneous	Cutaneous lupus erythematosus	Pubtator	36212172	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Discoid	Discoid lupus erythematosus	Pubtator	36212172	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	18706081, 23623029, 29257335, 34079550, 35757684, 35967341, 36524113	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	18706081, 18755862, 29806091		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	LHGDN	18706081		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	30503506		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	29103029, 29552132, 29986702		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	25650658, 28210844		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	29552132		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	23109837, 28210844, 30626937		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	9840926		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	36510962	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	Pubtator	37118825	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	34580642	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	25650658, 28356064, 29103029, 29853604, 30626937		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	23345134		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	33061329	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	25650658, 28210844		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	28210844		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	28356064, 32641986	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	29552132		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	34622927	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	26917578	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	18581327	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	35958619	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	30626937		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	36510962	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	17543081		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocytopenia	Thrombocytopenia	Pubtator	18706081	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	36226612	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	33711033	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	34112144	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	24867262		★★★★★ ★☆☆☆☆ Found in Text Mining only

IFIT3 (interferon induced protein with tetratricopeptide repeats 3)