FCRL6 (Fc receptor like 6)

Gene

• Entrez ID: 343413
• Gene name: Fc receptor like 6
• Gene symbol: FCRL6
• Synonyms (NCBI Gene): FcRH6
• Chromosome: 1
• Chromosome location: 1q23.2

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT994193	hsa-miR-4528	CLIP-seq
MIRT994194	hsa-miR-4795-3p	CLIP-seq
MIRT994195	hsa-miR-4803	CLIP-seq
MIRT994196	hsa-miR-802	CLIP-seq
MIRT2228960	hsa-miR-3136-5p	CLIP-seq
MIRT2228961	hsa-miR-34c-3p	CLIP-seq
MIRT2228962	hsa-miR-4420	CLIP-seq
MIRT2228963	hsa-miR-4439	CLIP-seq
MIRT2228964	hsa-miR-4513	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004888	Function	Transmembrane signaling receptor activity	IBA
GO:0005515	Function	Protein binding	IPI	20933011, 32296183
GO:0005886	Component	Plasma membrane	IDA	18991291, 20933011
GO:0005886	Component	Plasma membrane	IEA
GO:0006955	Process	Immune response	IBA
GO:0007166	Process	Cell surface receptor signaling pathway	IBA
GO:0009897	Component	External side of plasma membrane	IBA
GO:0009897	Component	External side of plasma membrane	IDA	17213291
GO:0009986	Component	Cell surface	IEA
GO:0016020	Component	Membrane	IEA
GO:0019902	Function	Phosphatase binding	IPI	20933011
GO:0019903	Function	Protein phosphatase binding	IEA
GO:0019903	Function	Protein phosphatase binding	IPI	20933011
GO:0042289	Function	MHC class II protein binding	IDA	20519654

Other IDs

• MIM: 613562
• HGNC: 31910
• e!Ensembl: ENSG00000181036

Protein

• UniProt ID: Q6DN72
• Protein name: Fc receptor-like protein 6 (FcR-like protein 6) (FcRL6) (Fc receptor homolog 6) (FcRH6) (IFGP6)
• Protein function: Acts as a MHC class II receptor (PubMed:20519654). When stimulated on its own, does not play a role in cytokine production or the release of cytotoxic granules by NK cells and cytotoxic CD8(+) T cells (PubMed:17213291, PubMed:18991291). Does not
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13895	Ig_2	19 → 104	Immunoglobulin domain	Domain
  PF13895	Ig_2	111 → 200	Immunoglobulin domain	Domain
  PF13927	Ig_3	206 → 280		Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed by cytolytic cells including NK cells, effector and effector-memory CD8(+) T-cells, and a subset of NKT cells (at protein level) (PubMed:17213291, PubMed:18991291, PubMed:20933011). Also expressed in gamma delta T cells and i
• Sequence:

  MLLWTAVLLFVPCVGKTVWLYLQAWPNPVFEGDALTLRCQGWKNTPLSQVKFYRDGKFLH
  FSKENQTLSMGAATVQSRGQYSCSGQVMYIPQTFTQTSETAMVQVQELFPPPVLSAIPSP
  EPREGSLVTLRCQTKLHPLRSALRLLFSFHKDGHTLQDRGPHPELCIPGAKEGDSGLYWC
  EVAPEGGQVQKQSPQLEVRVQAPVSRPVLTLHHGPADPAVGDMVQLLCEAQRGSPPILYS
  FYLDEKIVGNHSAPCGGTTSLLFPVKSEQDAGNYSCEAENSVSRERSEPKKLSLKGSQVL
  FTPASNWLVPWLPASLLGLMVIAAALLVYVRSWRKAGPLPSQIPPTAPGGEQCPLYANVH
  HQKGKDEGVVYSVVHRTSKRSEARSAEFTVGRKDSSIICAEVRCLQPSEVSSTEVNMRSR
  TLQEPLSDCEEVLC

• Sequence length: 434

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLOMERULONEPHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTERSTITIAL LUNG DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL OR BEHAVIOURAL DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHIATRIC DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TOURETTE SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Arteriosclerosis	Arteriosclerosis	BEFREE	17456471		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	17456471		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	22884899		★☆☆☆☆ Found in Text Mining only
Disseminated Intravascular Coagulation	Disseminated Intravascular Coagulation	BEFREE	25246042		★☆☆☆☆ Found in Text Mining only
Hematological Disease	Hematological Disease	BEFREE	20933011		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	16014635		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	GWASDB_DG	21642993		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	30568030		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	29689251		★☆☆☆☆ Found in Text Mining only