Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	3434
Gene name	Interferon induced protein with tetratricopeptide repeats 1
Gene symbol	IFIT1
Synonyms (NCBI Gene)	C56G10P1IFI-56IFI-56KIFI56IFIT-1IFNAI1ISG56P56RNM561
Chromosome	10
Chromosome location	10q23.31
Summary	This gene encodes a protein containing tetratricopeptide repeats that was originally identified as induced upon treatment with interferon. The encoded protein may inhibit viral replication and translational initiation. This gene is located in a cluster on

102

Show/Hide all (102)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020013	hsa-miR-375	Microarray	20215506
MIRT021232	hsa-miR-146a-5p	Microarray	18057241
MIRT024022	hsa-miR-1-3p	Microarray	18668037
MIRT437408	hsa-miR-203a-3p	Next Generation Sequencing (NGS)qRT-PCRWestern blot	23785202
MIRT709996	hsa-miR-126-5p	HITS-CLIP	19536157
MIRT709995	hsa-miR-1237-3p	HITS-CLIP	19536157
MIRT709994	hsa-miR-1248	HITS-CLIP	19536157
MIRT709992	hsa-miR-4795-3p	HITS-CLIP	19536157
MIRT709993	hsa-miR-6868-3p	HITS-CLIP	19536157
MIRT445799	hsa-miR-380-3p	PAR-CLIP	22100165
MIRT445797	hsa-miR-6516-3p	PAR-CLIP	22100165
MIRT445796	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT445795	hsa-miR-2054	PAR-CLIP	22100165
MIRT445794	hsa-miR-578	PAR-CLIP	22100165
MIRT445793	hsa-miR-335-3p	PAR-CLIP	22100165
MIRT445799	hsa-miR-380-3p	PAR-CLIP	22100165
MIRT445798	hsa-miR-1250-3p	PAR-CLIP	22100165
MIRT445797	hsa-miR-6516-3p	PAR-CLIP	22100165
MIRT445796	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT445795	hsa-miR-2054	PAR-CLIP	22100165
MIRT445794	hsa-miR-578	PAR-CLIP	22100165
MIRT445793	hsa-miR-335-3p	PAR-CLIP	22100165
MIRT737067	hsa-miR-4756-5p	Luciferase reporter assayWestern blottingqRT-PCR	33707417
MIRT709996	hsa-miR-126-5p	HITS-CLIP	19536157
MIRT709995	hsa-miR-1237-3p	HITS-CLIP	19536157
MIRT709994	hsa-miR-1248	HITS-CLIP	19536157
MIRT709992	hsa-miR-4795-3p	HITS-CLIP	19536157
MIRT709993	hsa-miR-6868-3p	HITS-CLIP	19536157
MIRT445799	hsa-miR-380-3p	PAR-CLIP	22100165
MIRT445797	hsa-miR-6516-3p	PAR-CLIP	22100165
MIRT445796	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT445795	hsa-miR-2054	PAR-CLIP	22100165
MIRT445794	hsa-miR-578	PAR-CLIP	22100165
MIRT445793	hsa-miR-335-3p	PAR-CLIP	22100165
MIRT445799	hsa-miR-380-3p	PAR-CLIP	22100165
MIRT445798	hsa-miR-1250-3p	PAR-CLIP	22100165
MIRT445797	hsa-miR-6516-3p	PAR-CLIP	22100165
MIRT445796	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT445795	hsa-miR-2054	PAR-CLIP	22100165
MIRT445794	hsa-miR-578	PAR-CLIP	22100165
MIRT445793	hsa-miR-335-3p	PAR-CLIP	22100165
MIRT2246315	hsa-miR-329	CLIP-seq
MIRT2246316	hsa-miR-362-3p	CLIP-seq
MIRT2246317	hsa-miR-3941	CLIP-seq
MIRT2246318	hsa-miR-4272	CLIP-seq
MIRT2246319	hsa-miR-4666-5p	CLIP-seq
MIRT2246320	hsa-miR-600	CLIP-seq
MIRT2246321	hsa-miR-603	CLIP-seq
MIRT2549561	hsa-miR-3129-3p	CLIP-seq
MIRT2549562	hsa-miR-3143	CLIP-seq
MIRT2246315	hsa-miR-329	CLIP-seq
MIRT2246316	hsa-miR-362-3p	CLIP-seq
MIRT2549563	hsa-miR-374a	CLIP-seq
MIRT2549564	hsa-miR-374b	CLIP-seq
MIRT2549565	hsa-miR-376c	CLIP-seq
MIRT2246317	hsa-miR-3941	CLIP-seq
MIRT2549566	hsa-miR-409-3p	CLIP-seq
MIRT2246318	hsa-miR-4272	CLIP-seq
MIRT2549567	hsa-miR-4652-3p	CLIP-seq
MIRT2246319	hsa-miR-4666-5p	CLIP-seq
MIRT2549568	hsa-miR-4684-5p	CLIP-seq
MIRT2549569	hsa-miR-4753-3p	CLIP-seq
MIRT2549570	hsa-miR-4762-3p	CLIP-seq
MIRT2549571	hsa-miR-4766-5p	CLIP-seq
MIRT2549572	hsa-miR-4768-5p	CLIP-seq
MIRT2549573	hsa-miR-4778-5p	CLIP-seq
MIRT2549574	hsa-miR-485-3p	CLIP-seq
MIRT2549575	hsa-miR-499-3p	CLIP-seq
MIRT2549576	hsa-miR-499a-3p	CLIP-seq
MIRT2549577	hsa-miR-543	CLIP-seq
MIRT2549578	hsa-miR-570	CLIP-seq
MIRT2549579	hsa-miR-582-5p	CLIP-seq
MIRT2246320	hsa-miR-600	CLIP-seq
MIRT2246321	hsa-miR-603	CLIP-seq
MIRT2549580	hsa-miR-653	CLIP-seq
MIRT2549561	hsa-miR-3129-3p	CLIP-seq
MIRT2549562	hsa-miR-3143	CLIP-seq
MIRT2246315	hsa-miR-329	CLIP-seq
MIRT2246316	hsa-miR-362-3p	CLIP-seq
MIRT2549563	hsa-miR-374a	CLIP-seq
MIRT2549564	hsa-miR-374b	CLIP-seq
MIRT2549565	hsa-miR-376c	CLIP-seq
MIRT2246317	hsa-miR-3941	CLIP-seq
MIRT2549566	hsa-miR-409-3p	CLIP-seq
MIRT2246318	hsa-miR-4272	CLIP-seq
MIRT2549567	hsa-miR-4652-3p	CLIP-seq
MIRT2246319	hsa-miR-4666-5p	CLIP-seq
MIRT2549568	hsa-miR-4684-5p	CLIP-seq
MIRT2549569	hsa-miR-4753-3p	CLIP-seq
MIRT2549570	hsa-miR-4762-3p	CLIP-seq
MIRT2549571	hsa-miR-4766-5p	CLIP-seq
MIRT2549572	hsa-miR-4768-5p	CLIP-seq
MIRT2549573	hsa-miR-4778-5p	CLIP-seq
MIRT2549574	hsa-miR-485-3p	CLIP-seq
MIRT2549575	hsa-miR-499-3p	CLIP-seq
MIRT2549576	hsa-miR-499a-3p	CLIP-seq
MIRT2549577	hsa-miR-543	CLIP-seq
MIRT2549578	hsa-miR-570	CLIP-seq
MIRT2549579	hsa-miR-582-5p	CLIP-seq
MIRT2246320	hsa-miR-600	CLIP-seq
MIRT2246321	hsa-miR-603	CLIP-seq
MIRT2549580	hsa-miR-653	CLIP-seq

Show/Hide all (27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002376	Process	Immune system process	IEA
GO:0003723	Function	RNA binding	IBA
GO:0003723	Function	RNA binding	IDA	21642987
GO:0003723	Function	RNA binding	IEA
GO:0004857	Function	Enzyme inhibitor activity	IDA	19008854
GO:0005515	Function	Protein binding	IPI	16189514, 19008854, 19416887, 21190939, 21612406, 21642987, 25416956, 27107012, 28514442, 30833792, 31515488, 33961781
GO:0005737	Component	Cytoplasm	IDA	19008854, 21642987
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0009615	Process	Response to virus	IDA	19416887
GO:0009615	Process	Response to virus	IMP	21642987
GO:0019060	Process	Intracellular transport of viral protein in host cell	IDA	19008854
GO:0043657	Component	Host cell	IEA
GO:0045070	Process	Positive regulation of viral genome replication	IDA	19416887
GO:0045071	Process	Negative regulation of viral genome replication	IMP	19008854, 21976647
GO:0045087	Process	Innate immune response	IEA
GO:0051607	Process	Defense response to virus	IBA
GO:0051607	Process	Defense response to virus	IEA
GO:0051707	Process	Response to other organism	IEA
GO:0071357	Process	Cellular response to type I interferon	IDA	19008854
GO:0071360	Process	Cellular response to exogenous dsRNA	IDA	19008854
GO:0140374	Process	Antiviral innate immune response	IDA	19008854
GO:0140374	Process	Antiviral innate immune response	IEP	25930096
GO:0140610	Function	RNA sequestering activity	IDA	21642987, 27240734, 28251928
GO:1904972	Process	Negative regulation of viral translation	IDA	27240734, 28251928

MIM	HGNC	e!Ensembl
147690	5407	ENSG00000185745

P09914

Protein name

Antiviral innate immune response effector IFIT1 (IFIT-1) (Interferon-induced 56 kDa protein) (IFI-56K) (P56) (Interferon-induced protein with tetratricopeptide repeats 1)

Protein function

Plays a key role in the innate immune response as part of an interferon-dependent multiprotein complex, recognizing and sequestering viral RNAs that lack host-specific 2'-O-methylation at their 5' cap. By distinguishing these RNAs from host mRNA

PDB

4HOU , 5UDI , 5UDJ , 5UDK , 5UDL , 5W5H , 5W5I , 6C6K

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13424	TPR_12	51 → 127		Repeat
PF13181	TPR_8	154 → 174	Tetratricopeptide repeat	Repeat

Sequence

MSTNGDDHQVKDSLEQLRCHFTWELSIDDDEMPDLENRVLDQIEFLDTKYSVGIHNLLAY
VKHLKGQNEEALKSLKEAENLMQEEHDNQANVRSLVTWGNFAWMYYHMGRLAEAQTYLDK
VENICKKLSNPFRYRMECPEIDCEEGWALLKCGGKNYERAKACFEKVLEVDPENPESSAG
YAISAYRLDGFKLATKNHKPFSLLPLRQAVRLNPDNGYIKVLLALKLQDEGQEAEGEKYI
EEALANMSSQTYVFRYAAKFYRRKGSVDKALELLKKALQETPTSVLLHHQIGLCYKAQMI
QIKEATKGQPRGQNREKLDKMIRSAIFHFESAVEKKPTFEVAHLDLARMYIEAGNHRKAE
ENFQKLLCMKPVVEETMQDIHFHYGRFQEFQKKSDVNAIIHYLKAIKIEQASLTRDKSIN
SLKKLVLRKLRRKALDLESLSLLGFVYKLEGNMNEALEYYERALRLAADFENSVRQGP

Sequence length

478

Interactions

View interactions

	KEGG		Reactome
	Hepatitis C		ISG15 antiviral mechanism Interferon alpha/beta signaling

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ENDOMETRIOSIS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (45)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute pancreatitis	Pancreatitis	BEFREE	28984787		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alternating hemiplegia of childhood	Alternating hemiplegia of childhood	Pubtator	26769142	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	24630834		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	36437453	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	23528130, 36766731	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	BEFREE	22406873		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	18715028, 37209778	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	11765912		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	28379462		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	30890645		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	19877033, 32252809, 37353938	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	35655479	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	35655479	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	CTD_human_DG	20864642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	CTD_human_DG	20864642		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gaucher Disease	Gaucher disease	Pubtator	30988500	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis Chronic	Hepatitis	Pubtator	28046052, 37209778	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	30890645		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Cutaneous	Cutaneous lupus erythematosus	Pubtator	34081040, 35356994	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	23623029, 29257335, 34079550, 35967341	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	26531267	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	12777642, 19793680, 26531267, 30930907		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	34782453	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	24086395, 29681787, 30626937		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microscopic Polyangiitis	Microscopic polyangiitis	Pubtator	23690996, 28569178	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	34384424	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	40590520	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	16527891		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	16527891	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	BEFREE	20484596		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nemaline myopathy 5	Nemaline myopathy	Pubtator	23528130	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	30626937		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	26252510, 29578204	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	28487939		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	33061329	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	34791638	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	27606687		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	28373872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	33253099	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	35958619, 37832090, 39331939	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	30626937		★★★★★ ★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	31270158		★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	25880423		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	37817224	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	23528130	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

IFIT1 (interferon induced protein with tetratricopeptide repeats 1)