Gene Gene information from NCBI Gene database.
Entrez ID 3434
Gene name Interferon induced protein with tetratricopeptide repeats 1
Gene symbol IFIT1
Synonyms (NCBI Gene)
C56G10P1IFI-56IFI-56KIFI56IFIT-1IFNAI1ISG56P56RNM561
Chromosome 10
Chromosome location 10q23.31
Summary This gene encodes a protein containing tetratricopeptide repeats that was originally identified as induced upon treatment with interferon. The encoded protein may inhibit viral replication and translational initiation. This gene is located in a cluster on
miRNA miRNA information provided by mirtarbase database.
102
miRTarBase ID miRNA Experiments Reference
MIRT020013 hsa-miR-375 Microarray 20215506
MIRT021232 hsa-miR-146a-5p Microarray 18057241
MIRT024022 hsa-miR-1-3p Microarray 18668037
MIRT437408 hsa-miR-203a-3p Next Generation Sequencing (NGS)qRT-PCRWestern blot 23785202
MIRT709996 hsa-miR-126-5p HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
27
GO ID Ontology Definition Evidence Reference
GO:0002376 Process Immune system process IEA
GO:0003723 Function RNA binding IBA
GO:0003723 Function RNA binding IDA 21642987
GO:0003723 Function RNA binding IEA
GO:0004857 Function Enzyme inhibitor activity IDA 19008854
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
147690 5407 ENSG00000185745
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P09914
Protein name Antiviral innate immune response effector IFIT1 (IFIT-1) (Interferon-induced 56 kDa protein) (IFI-56K) (P56) (Interferon-induced protein with tetratricopeptide repeats 1)
Protein function Plays a key role in the innate immune response as part of an interferon-dependent multiprotein complex, recognizing and sequestering viral RNAs that lack host-specific 2'-O-methylation at their 5' cap. By distinguishing these RNAs from host mRNA
PDB 4HOU , 5UDI , 5UDJ , 5UDK , 5UDL , 5W5H , 5W5I , 6C6K
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13424 TPR_12 51 127 Repeat
PF13181 TPR_8 154 174 Tetratricopeptide repeat Repeat
Sequence
MSTNGDDHQVKDSLEQLRCHFTWELSIDDDEMPDLENRVLDQIEFLDTKYSVGIHNLLAY
VKHLKGQNEEALKSLKEAENLMQEEHDNQANVRSLVTWGNFAWMYYHMGRLAEAQTYLDK
VENICKK
LSNPFRYRMECPEIDCEEGWALLKCGGKNYERAKACFEKVLEVDPENPESSAG
YAISAYRLDGFKLATKNHKPFSLLPLRQAVRLNPDNGYIKVLLALKLQDEGQEAEGEKYI
EEALANMSSQTYVFRYAAKFYRRKGSVDKALELLKKALQETPTSVLLHHQIGLCYKAQMI
QIKEATKGQPRGQNREKLDKMIRSAIFHFESAVEKKPTFEVAHLDLARMYIEAGNHRKAE
ENFQKLLCMKPVVEETMQDIHFHYGRFQEFQKKSDVNAIIHYLKAIKIEQASLTRDKSIN
SLKKLVLRKLRRKALDLESLSLLGFVYKLEGNMNEALEYYERALRLAADFENSVRQGP
Sequence length 478
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Hepatitis C   ISG15 antiviral mechanism
Interferon alpha/beta signaling
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ENDOMETRIOSIS CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Acute pancreatitis Pancreatitis BEFREE 28984787
★☆☆☆☆
Found in Text Mining only
Alternating hemiplegia of childhood Alternating hemiplegia of childhood Pubtator 26769142 Associate
★☆☆☆☆
Found in Text Mining only
Astrocytoma Astrocytoma BEFREE 24630834
★☆☆☆☆
Found in Text Mining only
Atherosclerosis Atherosclerosis Pubtator 36437453 Associate
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Breast neoplasm Pubtator 23528130, 36766731 Associate
★☆☆☆☆
Found in Text Mining only
Bronchiolitis Bronchiolitis BEFREE 22406873
★☆☆☆☆
Found in Text Mining only
Carcinoma Hepatocellular Hepatocellular carcinoma Pubtator 18715028, 37209778 Associate
★☆☆☆☆
Found in Text Mining only
Cervix carcinoma Cervix carcinoma BEFREE 11765912
★☆☆☆☆
Found in Text Mining only
Chronic Obstructive Airway Disease Chronic Obstructive Pulmonary Disease BEFREE 28379462
★☆☆☆☆
Found in Text Mining only
Cognition Disorders Cognitive disorder BEFREE 30890645
★☆☆☆☆
Found in Text Mining only