Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	3430
Gene name	Interferon induced protein 35
Gene symbol	IFI35
Synonyms (NCBI Gene)	IFP35
Chromosome	17
Chromosome location	17q21.31

Show/Hide all (41)

miRTarBase ID	miRNA	Experiments
MIRT2549311	hsa-miR-1208	CLIP-seq
MIRT2549312	hsa-miR-1255a	CLIP-seq
MIRT2549313	hsa-miR-1255b	CLIP-seq
MIRT2549314	hsa-miR-146a	CLIP-seq
MIRT2549315	hsa-miR-146b-5p	CLIP-seq
MIRT2549316	hsa-miR-1470	CLIP-seq
MIRT2549317	hsa-miR-1908	CLIP-seq
MIRT2549318	hsa-miR-1972	CLIP-seq
MIRT2549319	hsa-miR-199a-5p	CLIP-seq
MIRT2549320	hsa-miR-199b-5p	CLIP-seq
MIRT2549321	hsa-miR-3150a-3p	CLIP-seq
MIRT2549322	hsa-miR-3175	CLIP-seq
MIRT2549323	hsa-miR-337-3p	CLIP-seq
MIRT2549324	hsa-miR-3605-5p	CLIP-seq
MIRT2549325	hsa-miR-4302	CLIP-seq
MIRT2549326	hsa-miR-4651	CLIP-seq
MIRT2549327	hsa-miR-4730	CLIP-seq
MIRT2549328	hsa-miR-491-5p	CLIP-seq
MIRT2549329	hsa-miR-589	CLIP-seq
MIRT2549330	hsa-miR-608	CLIP-seq
MIRT2549331	hsa-miR-663	CLIP-seq
MIRT2549332	hsa-miR-939	CLIP-seq
MIRT2549311	hsa-miR-1208	CLIP-seq
MIRT2549314	hsa-miR-146a	CLIP-seq
MIRT2549315	hsa-miR-146b-5p	CLIP-seq
MIRT2549316	hsa-miR-1470	CLIP-seq
MIRT2549317	hsa-miR-1908	CLIP-seq
MIRT2549318	hsa-miR-1972	CLIP-seq
MIRT2549319	hsa-miR-199a-5p	CLIP-seq
MIRT2549320	hsa-miR-199b-5p	CLIP-seq
MIRT2549321	hsa-miR-3150a-3p	CLIP-seq
MIRT2549322	hsa-miR-3175	CLIP-seq
MIRT2549323	hsa-miR-337-3p	CLIP-seq
MIRT2549325	hsa-miR-4302	CLIP-seq
MIRT2549326	hsa-miR-4651	CLIP-seq
MIRT2549327	hsa-miR-4730	CLIP-seq
MIRT2549328	hsa-miR-491-5p	CLIP-seq
MIRT2549329	hsa-miR-589	CLIP-seq
MIRT2549330	hsa-miR-608	CLIP-seq
MIRT2549331	hsa-miR-663	CLIP-seq
MIRT2549332	hsa-miR-939	CLIP-seq

Show/Hide all (30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002281	Process	Macrophage activation involved in immune response	IDA	29038465
GO:0002281	Process	Macrophage activation involved in immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0005515	Function	Protein binding	IPI	8954125, 10779520, 10950963, 18624398, 26342464, 28514442, 32296183, 32814053
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IDA	29038465
GO:0005615	Component	Extracellular space	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	8288566, 10950963
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005730	Component	Nucleolus	IDA
GO:0005737	Component	Cytoplasm	IDA	10950963
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA	10779520, 10950963
GO:0005829	Component	Cytosol	TAS
GO:0008285	Process	Negative regulation of cell population proliferation	IMP	29350881
GO:0016020	Component	Membrane	IDA	10950963
GO:0034145	Process	Positive regulation of toll-like receptor 4 signaling pathway	IDA	29038465
GO:0042802	Function	Identical protein binding	IDA	10950963
GO:0045087	Process	Innate immune response	IEA
GO:0045088	Process	Regulation of innate immune response	IEA
GO:0045089	Process	Positive regulation of innate immune response	IDA	29038465
GO:0045089	Process	Positive regulation of innate immune response	IEA
GO:0050729	Process	Positive regulation of inflammatory response	IDA	29038465
GO:0050729	Process	Positive regulation of inflammatory response	IEA
GO:1901223	Process	Negative regulation of non-canonical NF-kappaB signal transduction	IEA
GO:1901223	Process	Negative regulation of non-canonical NF-kappaB signal transduction	IMP	29350881
GO:1901224	Process	Positive regulation of non-canonical NF-kappaB signal transduction	IEA
GO:1901224	Process	Positive regulation of non-canonical NF-kappaB signal transduction	ISS

MIM	HGNC	e!Ensembl
600735	5399	ENSG00000068079

P80217

Protein name

Interferon-induced 35 kDa protein (IFP 35) (Ifi-35)

Protein function

Acts as a signaling pathway regulator involved in innate immune system response (PubMed:26342464, PubMed:29038465, PubMed:29350881). In response to interferon IFN-alpha, associates in a complex with signaling pathway regulator NMI to regulate im

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07334	IFP_35_N	8 → 80	Interferon-induced 35 kDa protein (IFP 35) N-terminus	Family
PF07292	NID	81 → 170	Nmi/IFP 35 domain (NID)	Domain
PF07292	NID	179 → 266	Nmi/IFP 35 domain (NID)	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in a wide range of cell types, including fibroblasts, macrophages, and epithelial cells. {ECO:0000269|PubMed:29038465, ECO:0000269|PubMed:8288566}.

Sequence

MSAPLDAALHALQEEQARLKMRLWDLQQLRKELGDSPKDKVPFSVPKIPLVFRGHTQQDP
EVPKSLVSNLRIHCPLLAGSALITFDDPKVAEQVLQQKEHTINMEECRLRVQVQPLELPM
VTTIQMSSQLSGRRVLVTGFPASLRLSEEELLDKLEIFFGKTRNGGGDVDVRELLPGSVM
LGFARDGVAQRLCQIGQFTVPLGGQQVPLRVSPYVNGEIQKAEIRSQPVPRSVLVLNIPD
ILDGPELHDVLEIHFQKPTRGGGEVEALTVVPQGQQGLAVFTSESG

Sequence length

286

Interactions

View interactions

	Reactome
			Interferon alpha/beta signaling

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (17)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Astrocytoma	Astrocytoma	BEFREE	28109979		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	26342464	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	27639618		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	31779701	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	35609018	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	24371060	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	35757684	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	28064541		★★★★★ ★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	CTD_human_DG	18539642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	32781067	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	Pubtator	35609018	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	23507374		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary syndrome	Pubtator	20698843	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin neoplasm	Pubtator	23226549	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	35844580	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vesicular Stomatitis	Vesicular Stomatitis	BEFREE	24371060		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vesicular Stomatitis	Vesicular stomatitis	Pubtator	24371060	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

IFI35 (interferon induced protein 35)