ZNF404 (zinc finger protein 404)

Gene

• Entrez ID: 342908
• Gene name: Zinc finger protein 404
• Gene symbol: ZNF404
• Synonyms (NCBI Gene): -
• Chromosome: 19
• Chromosome location: 19q13.31

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT019824	hsa-miR-375	Microarray	20215506
MIRT1523938	hsa-miR-1227	CLIP-seq
MIRT1523939	hsa-miR-455-5p	CLIP-seq
MIRT1523940	hsa-miR-532-5p	CLIP-seq
MIRT2158382	hsa-miR-412	CLIP-seq
MIRT2464242	hsa-miR-3691-3p	CLIP-seq
MIRT2464243	hsa-miR-656	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	25416956
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0046872	Function	Metal ion binding	IEA

Other IDs

• MIM: HGNC
• HGNC: N/A
• e!Ensembl: HGNC

Protein

• UniProt ID: Q494X3
• Protein name: Zinc finger protein 404
• Protein function: May be involved in transcriptional regulation.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01352	KRAB	5 → 46	KRAB box	Family
  PF00096	zf-C2H2	159 → 181	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	187 → 209	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	215 → 237	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	271 → 293	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	299 → 321	Zinc finger, C2H2 type	Domain
  PF13912	zf-C2H2_6	327 → 352		Domain
  PF00096	zf-C2H2	355 → 377	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	383 → 405	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	411 → 433	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	439 → 461	Zinc finger, C2H2 type	Domain
  PF13912	zf-C2H2_6	467 → 492		Domain
  PF00096	zf-C2H2	495 → 517	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	523 → 546	Zinc finger, C2H2 type	Domain

• Sequence:

  MARVPLTFSDVAIDFSQEEWEYLNSDQRDLYRDVMLENYTNLVSLDFNFTTESNKLSSEK
  RNYEVNAYHQETWKRNKTFNLMRFIFRTDPQYTIEFGRQQRPKVGCFSQMIFKKHKSLPL
  HKRNNTREKSYECKEYKKGFRKYLHLTEHLRDHTGVIPYECNECGKAFVVFQHFIRHRKI
  HTDLKPYECNGCEKAFRFYSQLIQHQIIHTGMKPYECKQCGKAFRRHSHLTEHQKIHVGL
  KPFECKECGETFRLYRHMCLHQKIHHGVKPYKCKECGKAFGHRSSLYQHKKIHSGEKPYK
  CEQCEKAFVRSYLLVEHQRSHTGEKPHECMECGKAFGKGSSLLKHKRIHSSEKLYDCKDC
  GKAFCRGSQLTQHQRIHTGEKPHECKECGKTFKLHSYLIQHQIIHTDLKPYECKQCGKAF
  SRVGDLKTHQSIHAGEKPYECKECGKTFRLNSQLIYHQTIHTGLKPYVCKECKKAFRSIS
  GLSQHKRIHTGEKPYECKECDKAFNRSDRLTQHETIHTGVKPQKCKECGKAFSHCYQLSQ
  HQRFHHGERLLM

• Sequence length: 552

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Acute myeloid leukemia	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEMORRHOID	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Breast Carcinoma	Breast Carcinoma	BEFREE	28422318, 28957321		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	29915430		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	28957321	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of breast	Breast Cancer	BEFREE	28422318, 28957321		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	29915430		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28957321		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	29915430		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	29915430		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	29915430		★☆☆☆☆ Found in Text Mining only