Gene Gene information from NCBI Gene database.
Entrez ID 341405
Gene name Ankyrin repeat domain 33
Gene symbol ANKRD33
Synonyms (NCBI Gene)
C12orf7PANKY
Chromosome 12
Chromosome location 12q13.13
miRNA miRNA information provided by mirtarbase database.
2
miRTarBase ID miRNA Experiments Reference
MIRT783499 hsa-miR-4436b-5p CLIP-seq
MIRT783500 hsa-miR-483-3p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
5
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
GO:0005634 Component Nucleus IEA
GO:0005737 Component Cytoplasm IEA
GO:0005829 Component Cytosol IEA
GO:0035914 Process Skeletal muscle cell differentiation IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
620857 13788 ENSG00000167612
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q7Z3H0
Protein name Photoreceptor ankyrin repeat protein (Ankyrin repeat domain-containing protein 33)
Protein function Acts as a transcriptional repressor for CRX-activated photoreceptor gene regulation.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF12796 Ank_2 99 197 Ankyrin repeats (3 copies) Repeat
Sequence
MKVQPSVTCVASWGGIVHLEAFGDPVIVLRGAWAVPRVDCLIDTLRTPNASCMRKGTHLL
VPCLEEEELALHRRRLDMSEALPCPGKETPTPGCRLGALYWACVHNDPTQLQAILDGGVS
PEEATQVDSNGRTGLMVACYHGFQSVVALLSHCPFLDVNQQDKGGDTALMLAAQAGHVPL
VSLLLNYYVGLDLERRD
QRGLTALMKAAMRNRCADLTAVDPVRGKTALEWAVLTDSFDTV
WRIRQLLRRPQVEQLSQHYKPEWPALSGLVAQAQAQAQVAPSLLERLQATLSLPFAPSPQ
EGGVLDHLVTATTSLASPFVTTACHTLCPDHPPSLGTRSKSVPELLGTAPPPPLVPQSPP
GSPQRSPWVFVPYQSPQGILSKCLQWLQPRDSTSPRPQVPKILLSKASSSSHQCQPKPSP
SGHQSLALPLWRYQELRIEKRKQEEEARMAQK
Sequence length 452
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
GOUT GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Gastric Adenocarcinoma Gastric Cancer BEFREE 31314707
★☆☆☆☆
Found in Text Mining only
Neoplasms Neoplasms BEFREE 31314707
★☆☆☆☆
Found in Text Mining only
Stomach Neoplasms Stomach Neoplasms BEFREE 31314707
★☆☆☆☆
Found in Text Mining only