Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	340719
Gene name	Nanos C2HC-type zinc finger 1
Gene symbol	NANOS1
Synonyms (NCBI Gene)	EC_Rep1aNOS-1NOS1SPGF12ZC2HC12A
Chromosome	10
Chromosome location	10q26.11
Summary	This gene encodes a CCHC-type zinc finger protein that is a member of the nanos family. This protein co-localizes with the RNA-binding protein pumilio RNA-binding family member 2 and may be involved in regulating translation as a post-transcriptional repr

Show/Hide all (4)

SNP ID	Visualize variation	Clinical significance	Consequence
rs538539239	GCCGCCGCCGCC>-,GCC,GCCGCC,GCCGCCGCC,GCCGCCGCCGCCGCC,GCCGCCGCCGCCGCCGCC,GCCGCCGCCGCCGCCGCCGCC,GCCGCCGCCGCCGCCGCCGCCGCC	Pathogenic, benign	Inframe deletion, coding sequence variant, inframe insertion
rs587777031	CTCCTCCTC>-,CTCCTC,CTCCTCCTCCTC	Conflicting-interpretations-of-pathogenicity	Coding sequence variant, inframe deletion, inframe insertion
rs587777767	G>A	Pathogenic	Coding sequence variant, missense variant
rs587777768	CG>TA	Pathogenic	Coding sequence variant, missense variant

478

Show/Hide all (478)

miRTarBase ID	miRNA	Experiments	Reference
MIRT037712	hsa-miR-744-5p	CLASH	23622248
MIRT611330	hsa-miR-1182	HITS-CLIP	19536157
MIRT611328	hsa-miR-140-3p	HITS-CLIP	19536157
MIRT614332	hsa-miR-3119	HITS-CLIP	19536157
MIRT611319	hsa-miR-3692-3p	HITS-CLIP	19536157
MIRT611330	hsa-miR-1182	HITS-CLIP	19536157
MIRT611328	hsa-miR-140-3p	HITS-CLIP	19536157
MIRT611319	hsa-miR-3692-3p	HITS-CLIP	19536157
MIRT701555	hsa-miR-6811-3p	HITS-CLIP	23313552
MIRT701554	hsa-miR-552-5p	HITS-CLIP	23313552
MIRT614337	hsa-miR-8485	HITS-CLIP	23824327
MIRT614336	hsa-miR-6768-5p	HITS-CLIP	23824327
MIRT614335	hsa-miR-3622a-5p	HITS-CLIP	23824327
MIRT614334	hsa-miR-4269	HITS-CLIP	23824327
MIRT614333	hsa-miR-6715b-5p	HITS-CLIP	23824327
MIRT626385	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT614337	hsa-miR-8485	HITS-CLIP	23824327
MIRT614336	hsa-miR-6768-5p	HITS-CLIP	23824327
MIRT614335	hsa-miR-3622a-5p	HITS-CLIP	23824327
MIRT614334	hsa-miR-4269	HITS-CLIP	23824327
MIRT614333	hsa-miR-6715b-5p	HITS-CLIP	23824327
MIRT626385	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT614337	hsa-miR-8485	HITS-CLIP	23824327
MIRT614336	hsa-miR-6768-5p	HITS-CLIP	23824327
MIRT614337	hsa-miR-8485	HITS-CLIP	23824327
MIRT614336	hsa-miR-6768-5p	HITS-CLIP	23824327
MIRT614335	hsa-miR-3622a-5p	HITS-CLIP	23824327
MIRT614334	hsa-miR-4269	HITS-CLIP	23824327
MIRT614333	hsa-miR-6715b-5p	HITS-CLIP	23824327
MIRT626385	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT647778	hsa-miR-605-5p	HITS-CLIP	23824327
MIRT647776	hsa-miR-4762-5p	HITS-CLIP	23824327
MIRT647777	hsa-miR-339-5p	HITS-CLIP	23824327
MIRT647775	hsa-miR-1266-3p	HITS-CLIP	23824327
MIRT647774	hsa-miR-519d-5p	HITS-CLIP	23824327
MIRT647772	hsa-miR-4757-5p	HITS-CLIP	23824327
MIRT647773	hsa-miR-6744-3p	HITS-CLIP	23824327
MIRT647771	hsa-miR-1206	HITS-CLIP	23824327
MIRT647770	hsa-miR-6853-3p	HITS-CLIP	23824327
MIRT647769	hsa-miR-6878-3p	HITS-CLIP	23824327
MIRT611331	hsa-miR-3158-3p	HITS-CLIP	23824327
MIRT611328	hsa-miR-140-3p	HITS-CLIP	23824327
MIRT611327	hsa-miR-4721	HITS-CLIP	23824327
MIRT611319	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT611331	hsa-miR-3158-3p	HITS-CLIP	23824327
MIRT611330	hsa-miR-1182	HITS-CLIP	23824327
MIRT611328	hsa-miR-140-3p	HITS-CLIP	23824327
MIRT611327	hsa-miR-4721	HITS-CLIP	23824327
MIRT614332	hsa-miR-3119	HITS-CLIP	23824327
MIRT611319	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT611331	hsa-miR-3158-3p	HITS-CLIP	23824327
MIRT611330	hsa-miR-1182	HITS-CLIP	23824327
MIRT611328	hsa-miR-140-3p	HITS-CLIP	23824327
MIRT611327	hsa-miR-4721	HITS-CLIP	23824327
MIRT614332	hsa-miR-3119	HITS-CLIP	23824327
MIRT611319	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT614337	hsa-miR-8485	HITS-CLIP	23824327
MIRT614336	hsa-miR-6768-5p	HITS-CLIP	23824327
MIRT614335	hsa-miR-3622a-5p	HITS-CLIP	23824327
MIRT614334	hsa-miR-4269	HITS-CLIP	23824327
MIRT614333	hsa-miR-6715b-5p	HITS-CLIP	23824327
MIRT614337	hsa-miR-8485	HITS-CLIP	23824327
MIRT614336	hsa-miR-6768-5p	HITS-CLIP	23824327
MIRT614335	hsa-miR-3622a-5p	HITS-CLIP	23824327
MIRT614334	hsa-miR-4269	HITS-CLIP	23824327
MIRT614333	hsa-miR-6715b-5p	HITS-CLIP	23824327
MIRT614337	hsa-miR-8485	HITS-CLIP	23824327
MIRT614336	hsa-miR-6768-5p	HITS-CLIP	23824327
MIRT614335	hsa-miR-3622a-5p	HITS-CLIP	23824327
MIRT614334	hsa-miR-4269	HITS-CLIP	23824327
MIRT614333	hsa-miR-6715b-5p	HITS-CLIP	23824327
MIRT614337	hsa-miR-8485	HITS-CLIP	23824327
MIRT614336	hsa-miR-6768-5p	HITS-CLIP	23824327
MIRT614335	hsa-miR-3622a-5p	HITS-CLIP	23824327
MIRT614334	hsa-miR-4269	HITS-CLIP	23824327
MIRT614333	hsa-miR-6715b-5p	HITS-CLIP	23824327
MIRT626388	hsa-miR-6884-3p	HITS-CLIP	23824327
MIRT626387	hsa-miR-3136-3p	HITS-CLIP	23824327
MIRT626386	hsa-miR-7155-3p	HITS-CLIP	23824327
MIRT626385	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT611331	hsa-miR-3158-3p	HITS-CLIP	23824327
MIRT611330	hsa-miR-1182	HITS-CLIP	23824327
MIRT611328	hsa-miR-140-3p	HITS-CLIP	23824327
MIRT611327	hsa-miR-4721	HITS-CLIP	23824327
MIRT614332	hsa-miR-3119	HITS-CLIP	23824327
MIRT611319	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT611331	hsa-miR-3158-3p	HITS-CLIP	23824327
MIRT611330	hsa-miR-1182	HITS-CLIP	23824327
MIRT611328	hsa-miR-140-3p	HITS-CLIP	23824327
MIRT611327	hsa-miR-4721	HITS-CLIP	23824327
MIRT614332	hsa-miR-3119	HITS-CLIP	23824327
MIRT611319	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT614337	hsa-miR-8485	HITS-CLIP	23824327
MIRT614336	hsa-miR-6768-5p	HITS-CLIP	23824327
MIRT614335	hsa-miR-3622a-5p	HITS-CLIP	23824327
MIRT614334	hsa-miR-4269	HITS-CLIP	23824327
MIRT614333	hsa-miR-6715b-5p	HITS-CLIP	23824327
MIRT611331	hsa-miR-3158-3p	HITS-CLIP	23824327
MIRT611330	hsa-miR-1182	HITS-CLIP	23824327
MIRT611328	hsa-miR-140-3p	HITS-CLIP	23824327
MIRT611327	hsa-miR-4721	HITS-CLIP	23824327
MIRT614332	hsa-miR-3119	HITS-CLIP	23824327
MIRT611319	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT611331	hsa-miR-3158-3p	HITS-CLIP	23824327
MIRT611330	hsa-miR-1182	HITS-CLIP	23824327
MIRT611329	hsa-miR-6871-5p	HITS-CLIP	23824327
MIRT611328	hsa-miR-140-3p	HITS-CLIP	23824327
MIRT611327	hsa-miR-4721	HITS-CLIP	23824327
MIRT611326	hsa-miR-1273h-5p	HITS-CLIP	23824327
MIRT611325	hsa-miR-30b-3p	HITS-CLIP	23824327
MIRT611324	hsa-miR-3689a-3p	HITS-CLIP	23824327
MIRT611323	hsa-miR-3689b-3p	HITS-CLIP	23824327
MIRT611322	hsa-miR-3689c	HITS-CLIP	23824327
MIRT611321	hsa-miR-6779-5p	HITS-CLIP	23824327
MIRT611320	hsa-miR-6780a-5p	HITS-CLIP	23824327
MIRT611319	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT493015	hsa-miR-504-5p	PAR-CLIP	23592263
MIRT493014	hsa-miR-4292	PAR-CLIP	23592263
MIRT493013	hsa-miR-6791-5p	PAR-CLIP	23592263
MIRT493012	hsa-miR-939-3p	PAR-CLIP	23592263
MIRT493011	hsa-miR-4486	PAR-CLIP	23592263
MIRT493010	hsa-miR-4725-5p	PAR-CLIP	23592263
MIRT493008	hsa-miR-3184-5p	PAR-CLIP	23592263
MIRT493009	hsa-miR-423-5p	PAR-CLIP	23592263
MIRT493007	hsa-miR-381-5p	PAR-CLIP	23592263
MIRT493006	hsa-miR-3960	PAR-CLIP	23592263
MIRT493005	hsa-miR-8072	PAR-CLIP	23592263
MIRT493004	hsa-miR-4746-3p	PAR-CLIP	23592263
MIRT493003	hsa-miR-4467	PAR-CLIP	23592263
MIRT493001	hsa-miR-3180	PAR-CLIP	23592263
MIRT493002	hsa-miR-3180-3p	PAR-CLIP	23592263
MIRT493000	hsa-miR-3196	PAR-CLIP	23592263
MIRT492999	hsa-miR-6816-5p	PAR-CLIP	23592263
MIRT492998	hsa-miR-4321	PAR-CLIP	23592263
MIRT492997	hsa-miR-4737	PAR-CLIP	23592263
MIRT611330	hsa-miR-1182	HITS-CLIP	19536157
MIRT611328	hsa-miR-140-3p	HITS-CLIP	19536157
MIRT614332	hsa-miR-3119	HITS-CLIP	19536157
MIRT611319	hsa-miR-3692-3p	HITS-CLIP	19536157
MIRT611330	hsa-miR-1182	HITS-CLIP	19536157
MIRT611328	hsa-miR-140-3p	HITS-CLIP	19536157
MIRT611319	hsa-miR-3692-3p	HITS-CLIP	19536157
MIRT701555	hsa-miR-6811-3p	HITS-CLIP	23313552
MIRT701554	hsa-miR-552-5p	HITS-CLIP	23313552
MIRT575959	hsa-miR-8485	HITS-CLIP	23824327
MIRT575958	hsa-miR-6768-5p	HITS-CLIP	23824327
MIRT575957	hsa-miR-3622a-5p	HITS-CLIP	23824327
MIRT575956	hsa-miR-4269	HITS-CLIP	23824327
MIRT575955	hsa-miR-6715b-5p	HITS-CLIP	23824327
MIRT575953	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT575959	hsa-miR-8485	HITS-CLIP	23824327
MIRT575958	hsa-miR-6768-5p	HITS-CLIP	23824327
MIRT575957	hsa-miR-3622a-5p	HITS-CLIP	23824327
MIRT575956	hsa-miR-4269	HITS-CLIP	23824327
MIRT575955	hsa-miR-6715b-5p	HITS-CLIP	23824327
MIRT575953	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT575959	hsa-miR-8485	HITS-CLIP	23824327
MIRT575958	hsa-miR-6768-5p	HITS-CLIP	23824327
MIRT575959	hsa-miR-8485	HITS-CLIP	23824327
MIRT575958	hsa-miR-6768-5p	HITS-CLIP	23824327
MIRT575957	hsa-miR-3622a-5p	HITS-CLIP	23824327
MIRT575956	hsa-miR-4269	HITS-CLIP	23824327
MIRT575955	hsa-miR-6715b-5p	HITS-CLIP	23824327
MIRT575953	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT647778	hsa-miR-605-5p	HITS-CLIP	23824327
MIRT647776	hsa-miR-4762-5p	HITS-CLIP	23824327
MIRT647777	hsa-miR-339-5p	HITS-CLIP	23824327
MIRT647775	hsa-miR-1266-3p	HITS-CLIP	23824327
MIRT647774	hsa-miR-519d-5p	HITS-CLIP	23824327
MIRT647772	hsa-miR-4757-5p	HITS-CLIP	23824327
MIRT647773	hsa-miR-6744-3p	HITS-CLIP	23824327
MIRT647771	hsa-miR-1206	HITS-CLIP	23824327
MIRT647770	hsa-miR-6853-3p	HITS-CLIP	23824327
MIRT647769	hsa-miR-6878-3p	HITS-CLIP	23824327
MIRT611331	hsa-miR-3158-3p	HITS-CLIP	23824327
MIRT611328	hsa-miR-140-3p	HITS-CLIP	23824327
MIRT611327	hsa-miR-4721	HITS-CLIP	23824327
MIRT611319	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT611331	hsa-miR-3158-3p	HITS-CLIP	23824327
MIRT611330	hsa-miR-1182	HITS-CLIP	23824327
MIRT611328	hsa-miR-140-3p	HITS-CLIP	23824327
MIRT611327	hsa-miR-4721	HITS-CLIP	23824327
MIRT614332	hsa-miR-3119	HITS-CLIP	23824327
MIRT611319	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT611331	hsa-miR-3158-3p	HITS-CLIP	23824327
MIRT611330	hsa-miR-1182	HITS-CLIP	23824327
MIRT611328	hsa-miR-140-3p	HITS-CLIP	23824327
MIRT611327	hsa-miR-4721	HITS-CLIP	23824327
MIRT614332	hsa-miR-3119	HITS-CLIP	23824327
MIRT611319	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT575959	hsa-miR-8485	HITS-CLIP	23824327
MIRT575958	hsa-miR-6768-5p	HITS-CLIP	23824327
MIRT575957	hsa-miR-3622a-5p	HITS-CLIP	23824327
MIRT575956	hsa-miR-4269	HITS-CLIP	23824327
MIRT575955	hsa-miR-6715b-5p	HITS-CLIP	23824327
MIRT575959	hsa-miR-8485	HITS-CLIP	23824327
MIRT575958	hsa-miR-6768-5p	HITS-CLIP	23824327
MIRT575957	hsa-miR-3622a-5p	HITS-CLIP	23824327
MIRT575956	hsa-miR-4269	HITS-CLIP	23824327
MIRT575955	hsa-miR-6715b-5p	HITS-CLIP	23824327
MIRT575959	hsa-miR-8485	HITS-CLIP	23824327
MIRT575958	hsa-miR-6768-5p	HITS-CLIP	23824327
MIRT575957	hsa-miR-3622a-5p	HITS-CLIP	23824327
MIRT575956	hsa-miR-4269	HITS-CLIP	23824327
MIRT575955	hsa-miR-6715b-5p	HITS-CLIP	23824327
MIRT575959	hsa-miR-8485	HITS-CLIP	23824327
MIRT575958	hsa-miR-6768-5p	HITS-CLIP	23824327
MIRT575957	hsa-miR-3622a-5p	HITS-CLIP	23824327
MIRT575956	hsa-miR-4269	HITS-CLIP	23824327
MIRT575955	hsa-miR-6715b-5p	HITS-CLIP	23824327
MIRT575954	hsa-miR-6884-3p	HITS-CLIP	23824327
MIRT626387	hsa-miR-3136-3p	HITS-CLIP	23824327
MIRT626386	hsa-miR-7155-3p	HITS-CLIP	23824327
MIRT575953	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT611331	hsa-miR-3158-3p	HITS-CLIP	23824327
MIRT611330	hsa-miR-1182	HITS-CLIP	23824327
MIRT611328	hsa-miR-140-3p	HITS-CLIP	23824327
MIRT611327	hsa-miR-4721	HITS-CLIP	23824327
MIRT614332	hsa-miR-3119	HITS-CLIP	23824327
MIRT611319	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT611331	hsa-miR-3158-3p	HITS-CLIP	23824327
MIRT611330	hsa-miR-1182	HITS-CLIP	23824327
MIRT611328	hsa-miR-140-3p	HITS-CLIP	23824327
MIRT611327	hsa-miR-4721	HITS-CLIP	23824327
MIRT614332	hsa-miR-3119	HITS-CLIP	23824327
MIRT611319	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT575959	hsa-miR-8485	HITS-CLIP	23824327
MIRT575958	hsa-miR-6768-5p	HITS-CLIP	23824327
MIRT575957	hsa-miR-3622a-5p	HITS-CLIP	23824327
MIRT575956	hsa-miR-4269	HITS-CLIP	23824327
MIRT575955	hsa-miR-6715b-5p	HITS-CLIP	23824327
MIRT611331	hsa-miR-3158-3p	HITS-CLIP	23824327
MIRT611330	hsa-miR-1182	HITS-CLIP	23824327
MIRT611328	hsa-miR-140-3p	HITS-CLIP	23824327
MIRT611327	hsa-miR-4721	HITS-CLIP	23824327
MIRT614332	hsa-miR-3119	HITS-CLIP	23824327
MIRT611319	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT611331	hsa-miR-3158-3p	HITS-CLIP	23824327
MIRT611330	hsa-miR-1182	HITS-CLIP	23824327
MIRT611329	hsa-miR-6871-5p	HITS-CLIP	23824327
MIRT611328	hsa-miR-140-3p	HITS-CLIP	23824327
MIRT611327	hsa-miR-4721	HITS-CLIP	23824327
MIRT611326	hsa-miR-1273h-5p	HITS-CLIP	23824327
MIRT611325	hsa-miR-30b-3p	HITS-CLIP	23824327
MIRT611324	hsa-miR-3689a-3p	HITS-CLIP	23824327
MIRT611323	hsa-miR-3689b-3p	HITS-CLIP	23824327
MIRT611322	hsa-miR-3689c	HITS-CLIP	23824327
MIRT611321	hsa-miR-6779-5p	HITS-CLIP	23824327
MIRT611320	hsa-miR-6780a-5p	HITS-CLIP	23824327
MIRT611319	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT493015	hsa-miR-504-5p	PAR-CLIP	23592263
MIRT493014	hsa-miR-4292	PAR-CLIP	23592263
MIRT493013	hsa-miR-6791-5p	PAR-CLIP	23592263
MIRT493012	hsa-miR-939-3p	PAR-CLIP	23592263
MIRT493011	hsa-miR-4486	PAR-CLIP	23592263
MIRT493010	hsa-miR-4725-5p	PAR-CLIP	23592263
MIRT493008	hsa-miR-3184-5p	PAR-CLIP	23592263
MIRT493009	hsa-miR-423-5p	PAR-CLIP	23592263
MIRT493007	hsa-miR-381-5p	PAR-CLIP	23592263
MIRT493006	hsa-miR-3960	PAR-CLIP	23592263
MIRT493005	hsa-miR-8072	PAR-CLIP	23592263
MIRT493004	hsa-miR-4746-3p	PAR-CLIP	23592263
MIRT493003	hsa-miR-4467	PAR-CLIP	23592263
MIRT493001	hsa-miR-3180	PAR-CLIP	23592263
MIRT493002	hsa-miR-3180-3p	PAR-CLIP	23592263
MIRT493000	hsa-miR-3196	PAR-CLIP	23592263
MIRT492999	hsa-miR-6816-5p	PAR-CLIP	23592263
MIRT492998	hsa-miR-4321	PAR-CLIP	23592263
MIRT492997	hsa-miR-4737	PAR-CLIP	23592263
MIRT1173342	hsa-miR-106a	CLIP-seq
MIRT1173343	hsa-miR-106b	CLIP-seq
MIRT1173344	hsa-miR-1178	CLIP-seq
MIRT1173345	hsa-miR-1207-3p	CLIP-seq
MIRT1173346	hsa-miR-122	CLIP-seq
MIRT1173347	hsa-miR-1258	CLIP-seq
MIRT1173348	hsa-miR-1267	CLIP-seq
MIRT1173349	hsa-miR-1285	CLIP-seq
MIRT1173350	hsa-miR-1290	CLIP-seq
MIRT1173351	hsa-miR-136	CLIP-seq
MIRT1173352	hsa-miR-17	CLIP-seq
MIRT1173353	hsa-miR-20a	CLIP-seq
MIRT1173354	hsa-miR-20b	CLIP-seq
MIRT1173355	hsa-miR-3135b	CLIP-seq
MIRT1173356	hsa-miR-3155	CLIP-seq
MIRT1173357	hsa-miR-3155b	CLIP-seq
MIRT1173358	hsa-miR-3163	CLIP-seq
MIRT1173359	hsa-miR-3167	CLIP-seq
MIRT1173360	hsa-miR-3184	CLIP-seq
MIRT1173361	hsa-miR-3187-5p	CLIP-seq
MIRT1173362	hsa-miR-3609	CLIP-seq
MIRT1173363	hsa-miR-3646	CLIP-seq
MIRT1173364	hsa-miR-3652	CLIP-seq
MIRT1173365	hsa-miR-3662	CLIP-seq
MIRT1173366	hsa-miR-378g	CLIP-seq
MIRT1173367	hsa-miR-3914	CLIP-seq
MIRT1173368	hsa-miR-3922-5p	CLIP-seq
MIRT1173369	hsa-miR-4430	CLIP-seq
MIRT1173370	hsa-miR-4519	CLIP-seq
MIRT1173371	hsa-miR-4690-3p	CLIP-seq
MIRT1173372	hsa-miR-4728-5p	CLIP-seq
MIRT1173373	hsa-miR-4742-5p	CLIP-seq
MIRT1173374	hsa-miR-4760-5p	CLIP-seq
MIRT1173375	hsa-miR-4772-5p	CLIP-seq
MIRT1173376	hsa-miR-4796-3p	CLIP-seq
MIRT1173377	hsa-miR-484	CLIP-seq
MIRT1173378	hsa-miR-498	CLIP-seq
MIRT1173379	hsa-miR-504	CLIP-seq
MIRT1173380	hsa-miR-514	CLIP-seq
MIRT1173381	hsa-miR-514b-3p	CLIP-seq
MIRT1173382	hsa-miR-515-3p	CLIP-seq
MIRT1173383	hsa-miR-519d	CLIP-seq
MIRT1173384	hsa-miR-519e	CLIP-seq
MIRT1173385	hsa-miR-548a-5p	CLIP-seq
MIRT1173386	hsa-miR-548ab	CLIP-seq
MIRT1173387	hsa-miR-548ah	CLIP-seq
MIRT1173388	hsa-miR-548ak	CLIP-seq
MIRT1173389	hsa-miR-548b-5p	CLIP-seq
MIRT1173390	hsa-miR-548c-5p	CLIP-seq
MIRT1173391	hsa-miR-548d-5p	CLIP-seq
MIRT1173392	hsa-miR-548h	CLIP-seq
MIRT1173393	hsa-miR-548i	CLIP-seq
MIRT1173394	hsa-miR-548j	CLIP-seq
MIRT1173395	hsa-miR-548k	CLIP-seq
MIRT1173396	hsa-miR-548l	CLIP-seq
MIRT1173397	hsa-miR-548n	CLIP-seq
MIRT1173398	hsa-miR-548t	CLIP-seq
MIRT1173399	hsa-miR-548w	CLIP-seq
MIRT1173400	hsa-miR-548y	CLIP-seq
MIRT1173401	hsa-miR-559	CLIP-seq
MIRT1173402	hsa-miR-612	CLIP-seq
MIRT1173403	hsa-miR-876-5p	CLIP-seq
MIRT1173404	hsa-miR-93	CLIP-seq
MIRT2050234	hsa-miR-1	CLIP-seq
MIRT1173344	hsa-miR-1178	CLIP-seq
MIRT1173345	hsa-miR-1207-3p	CLIP-seq
MIRT1173346	hsa-miR-122	CLIP-seq
MIRT1173348	hsa-miR-1267	CLIP-seq
MIRT2050235	hsa-miR-1281	CLIP-seq
MIRT2050236	hsa-miR-206	CLIP-seq
MIRT1173355	hsa-miR-3135b	CLIP-seq
MIRT1173356	hsa-miR-3155	CLIP-seq
MIRT1173357	hsa-miR-3155b	CLIP-seq
MIRT1173364	hsa-miR-3652	CLIP-seq
MIRT2050237	hsa-miR-3673	CLIP-seq
MIRT2050238	hsa-miR-3681	CLIP-seq
MIRT2050239	hsa-miR-4277	CLIP-seq
MIRT2050240	hsa-miR-4284	CLIP-seq
MIRT1173369	hsa-miR-4430	CLIP-seq
MIRT2050241	hsa-miR-4437	CLIP-seq
MIRT2050242	hsa-miR-4460	CLIP-seq
MIRT2050243	hsa-miR-4674	CLIP-seq
MIRT2050244	hsa-miR-4727-3p	CLIP-seq
MIRT2050245	hsa-miR-4742-3p	CLIP-seq
MIRT2050246	hsa-miR-4772-3p	CLIP-seq
MIRT1173377	hsa-miR-484	CLIP-seq
MIRT1173378	hsa-miR-498	CLIP-seq
MIRT2050247	hsa-miR-548u	CLIP-seq
MIRT2050248	hsa-miR-590-3p	CLIP-seq
MIRT2050249	hsa-miR-613	CLIP-seq
MIRT2050250	hsa-miR-619	CLIP-seq
MIRT2050251	hsa-miR-935	CLIP-seq
MIRT1173342	hsa-miR-106a	CLIP-seq
MIRT1173343	hsa-miR-106b	CLIP-seq
MIRT2279139	hsa-miR-1236	CLIP-seq
MIRT2279140	hsa-miR-1256	CLIP-seq
MIRT2050235	hsa-miR-1281	CLIP-seq
MIRT2279141	hsa-miR-1343	CLIP-seq
MIRT2279142	hsa-miR-145	CLIP-seq
MIRT2279143	hsa-miR-150	CLIP-seq
MIRT1173352	hsa-miR-17	CLIP-seq
MIRT2279144	hsa-miR-193a-5p	CLIP-seq
MIRT2279145	hsa-miR-1976	CLIP-seq
MIRT2279146	hsa-miR-2052	CLIP-seq
MIRT1173353	hsa-miR-20a	CLIP-seq
MIRT1173354	hsa-miR-20b	CLIP-seq
MIRT2279147	hsa-miR-302a	CLIP-seq
MIRT2279148	hsa-miR-302b	CLIP-seq
MIRT2279149	hsa-miR-302c	CLIP-seq
MIRT2279150	hsa-miR-302d	CLIP-seq
MIRT2279151	hsa-miR-302e	CLIP-seq
MIRT2279152	hsa-miR-3074-5p	CLIP-seq
MIRT2279153	hsa-miR-3124-3p	CLIP-seq
MIRT2279154	hsa-miR-3149	CLIP-seq
MIRT1173358	hsa-miR-3163	CLIP-seq
MIRT2279155	hsa-miR-3188	CLIP-seq
MIRT1173364	hsa-miR-3652	CLIP-seq
MIRT2279156	hsa-miR-3688-5p	CLIP-seq
MIRT2279157	hsa-miR-372	CLIP-seq
MIRT2279158	hsa-miR-373	CLIP-seq
MIRT2279159	hsa-miR-4257	CLIP-seq
MIRT2050239	hsa-miR-4277	CLIP-seq
MIRT2279160	hsa-miR-4279	CLIP-seq
MIRT2279161	hsa-miR-4328	CLIP-seq
MIRT1173369	hsa-miR-4430	CLIP-seq
MIRT2279162	hsa-miR-4481	CLIP-seq
MIRT2279163	hsa-miR-4503	CLIP-seq
MIRT2279164	hsa-miR-4522	CLIP-seq
MIRT2279165	hsa-miR-4643	CLIP-seq
MIRT2279166	hsa-miR-4668-3p	CLIP-seq
MIRT2279167	hsa-miR-4712-5p	CLIP-seq
MIRT2279168	hsa-miR-4722-3p	CLIP-seq
MIRT2279169	hsa-miR-4731-3p	CLIP-seq
MIRT2279170	hsa-miR-4731-5p	CLIP-seq
MIRT2279171	hsa-miR-4735-5p	CLIP-seq
MIRT2050245	hsa-miR-4742-3p	CLIP-seq
MIRT2279172	hsa-miR-4745-5p	CLIP-seq
MIRT2050246	hsa-miR-4772-3p	CLIP-seq
MIRT2279173	hsa-miR-4775	CLIP-seq
MIRT2279174	hsa-miR-4794	CLIP-seq
MIRT2279175	hsa-miR-4801	CLIP-seq
MIRT1173378	hsa-miR-498	CLIP-seq
MIRT2279176	hsa-miR-511	CLIP-seq
MIRT2279177	hsa-miR-512-3p	CLIP-seq
MIRT1173383	hsa-miR-519d	CLIP-seq
MIRT2279178	hsa-miR-520a-3p	CLIP-seq
MIRT2279179	hsa-miR-520b	CLIP-seq
MIRT2279180	hsa-miR-520c-3p	CLIP-seq
MIRT2279181	hsa-miR-520d-3p	CLIP-seq
MIRT2279182	hsa-miR-520e	CLIP-seq
MIRT2279183	hsa-miR-520g	CLIP-seq
MIRT2279184	hsa-miR-520h	CLIP-seq
MIRT2050248	hsa-miR-590-3p	CLIP-seq
MIRT2279185	hsa-miR-628-3p	CLIP-seq
MIRT2279186	hsa-miR-644	CLIP-seq
MIRT2279187	hsa-miR-648	CLIP-seq
MIRT2279188	hsa-miR-670	CLIP-seq
MIRT2279189	hsa-miR-770-5p	CLIP-seq
MIRT1173404	hsa-miR-93	CLIP-seq
MIRT2279190	hsa-miR-941	CLIP-seq
MIRT1173344	hsa-miR-1178	CLIP-seq
MIRT1173346	hsa-miR-122	CLIP-seq
MIRT1173355	hsa-miR-3135b	CLIP-seq
MIRT1173356	hsa-miR-3155	CLIP-seq
MIRT1173357	hsa-miR-3155b	CLIP-seq
MIRT1173364	hsa-miR-3652	CLIP-seq
MIRT1173369	hsa-miR-4430	CLIP-seq
MIRT2050245	hsa-miR-4742-3p	CLIP-seq
MIRT1173377	hsa-miR-484	CLIP-seq
MIRT2454828	hsa-miR-1231	CLIP-seq
MIRT2279140	hsa-miR-1256	CLIP-seq
MIRT2454829	hsa-miR-1264	CLIP-seq
MIRT2454830	hsa-miR-1299	CLIP-seq
MIRT2454831	hsa-miR-203	CLIP-seq
MIRT2454832	hsa-miR-3170	CLIP-seq
MIRT2279156	hsa-miR-3688-5p	CLIP-seq
MIRT2454833	hsa-miR-4288	CLIP-seq
MIRT2279171	hsa-miR-4735-5p	CLIP-seq
MIRT2454834	hsa-miR-495	CLIP-seq
MIRT2454835	hsa-miR-587	CLIP-seq
MIRT2454836	hsa-miR-632	CLIP-seq
MIRT2279186	hsa-miR-644	CLIP-seq
MIRT2279187	hsa-miR-648	CLIP-seq
MIRT2454837	hsa-miR-671-5p	CLIP-seq
MIRT2454838	hsa-miR-875-3p	CLIP-seq
MIRT2454839	hsa-miR-890	CLIP-seq
MIRT2454829	hsa-miR-1264	CLIP-seq
MIRT2454831	hsa-miR-203	CLIP-seq
MIRT2577314	hsa-miR-3169	CLIP-seq
MIRT2454832	hsa-miR-3170	CLIP-seq
MIRT2577315	hsa-miR-4326	CLIP-seq
MIRT2577316	hsa-miR-4436a	CLIP-seq
MIRT2279162	hsa-miR-4481	CLIP-seq
MIRT2577317	hsa-miR-4658	CLIP-seq
MIRT2279171	hsa-miR-4735-5p	CLIP-seq
MIRT2279172	hsa-miR-4745-5p	CLIP-seq
MIRT2577318	hsa-miR-4758-5p	CLIP-seq
MIRT2577319	hsa-miR-4759	CLIP-seq
MIRT2577320	hsa-miR-488	CLIP-seq
MIRT2454834	hsa-miR-495	CLIP-seq
MIRT2577321	hsa-miR-502-5p	CLIP-seq
MIRT2454839	hsa-miR-890	CLIP-seq
MIRT2279139	hsa-miR-1236	CLIP-seq
MIRT2050235	hsa-miR-1281	CLIP-seq
MIRT2685779	hsa-miR-129-3p	CLIP-seq
MIRT2279164	hsa-miR-4522	CLIP-seq
MIRT2050245	hsa-miR-4742-3p	CLIP-seq
MIRT1173378	hsa-miR-498	CLIP-seq
MIRT2279188	hsa-miR-670	CLIP-seq

Show/Hide all (27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001558	Process	Regulation of cell growth	IEA
GO:0001894	Process	Tissue homeostasis	IEA
GO:0003723	Function	RNA binding	IEA
GO:0003729	Function	MRNA binding	IBA
GO:0005515	Function	Protein binding	IPI	17047063, 19168546, 21800163, 24736845
GO:0005737	Component	Cytoplasm	IDA	12690449, 17047063
GO:0005737	Component	Cytoplasm	IEA
GO:0006417	Process	Regulation of translation	IEA
GO:0008047	Function	Enzyme activator activity	IDA	24736845
GO:0008047	Function	Enzyme activator activity	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0010608	Process	Post-transcriptional regulation of gene expression	IDA	25100735
GO:0010608	Process	Post-transcriptional regulation of gene expression	IEA
GO:0010631	Process	Epithelial cell migration	IDA	17047063
GO:0016477	Process	Cell migration	IDA	18223680
GO:0017148	Process	Negative regulation of translation	IBA
GO:0017148	Process	Negative regulation of translation	IDA	24736845
GO:0017148	Process	Negative regulation of translation	IEA
GO:0030371	Function	Translation repressor activity	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IBA
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	17047063, 19168546
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0048477	Process	Oogenesis	IBA
GO:0061157	Process	MRNA destabilization	IDA	24736845
GO:0061157	Process	MRNA destabilization	IEA
GO:0098749	Process	Cerebellar neuron development	IEA

MIM	HGNC	e!Ensembl
608226	23044	ENSG00000188613

Q8WY41

Protein name

Nanos homolog 1 (NOS-1) (EC_Rep1a)

Protein function

May act as a translational repressor which regulates translation of specific mRNAs by forming a complex with PUM2 that associates with the 3'-UTR of mRNA targets. Capable of interfering with the proadhesive and anti-invasive functions of E-cadhe

PDB

4CQO

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF05741	zf-nanos	214 → 267	Nanos RNA binding domain	Family

Tissue specificity

TISSUE SPECIFICITY: Testis and ovary (at protein level). Predominantly expressed in testis. Specifically expressed during germline development. In adult tissues, it is mainly expressed in spermatogonia, the stem cells of the germline. Also expressed durin

Sequence

MEAFPWAPRSPRRGRAPPPMALVPSARYVSAPGPAHPQPFSSWNDYLGLATLITKAVDGE
PRFGCARGGNGGGGSPPSSSSSSCCSPHTGAGPGALGPALGPPDYDEDDDDDSDEPGSRG
RYLGSALELRALELCAGPAEAGLLEERFAELSPFAGRAAAVLLGCAPAAAAAATTTSEAT
PREERAPAWAAEPRLHAASGAAAARLLKPELQVCVFCRNNKEAMALYTTHILKGPDGRVL
CPVLRRYTCPLCGASGDNAHTIKYCPLSKVPPPPARPPPRSARDGPPGKKLR

Sequence length

292

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Spermatogenic failure 12	Pathogenic	rs538539239	RCV000055618	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
MALE INFERTILITY WITH AZOOSPERMIA OR OLIGOZOOSPERMIA DUE TO SINGLE GENE MUTATION	—	CTD, Disgenet, Orphanet CTD, Disgenet, Orphanet CTD, Disgenet, Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MESOTHELIOMA, MALIGNANT	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NANOS1-related disorder	Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (394)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	19574086, 23937241, 24079724, 25684509, 8986967		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	GWASCAT_DG	26151821, 29917119		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	BEFREE	19574086, 23835861, 23937241		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma, Basal Cell	Adenoma	BEFREE	23937241, 8986967		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	19423521, 31287335		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	28290003		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Oligodendroglioma	Oligodendroglioma	BEFREE	28801347, 29470683		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	23342278, 23568283		★★★★★ ★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	23937241		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alveolar rhabdomyosarcoma	Alveolar Rhabdomyosarcoma	BEFREE	18303411		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	30704480	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	11344254	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	17099894, 9930658		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	LHGDN	17359361		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic astrocytoma	Anaplastic Astrocytoma	BEFREE	30279958		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic Oligodendroglioma	Anaplastic Oligodendroglioma	BEFREE	29470683		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	21976486		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	11751185		★★★★★ ★☆☆☆☆ Found in Text Mining only
Angioimmunoblastic Lymphadenopathy	Angioimmunoblastic T-cell lymphoma	BEFREE	16931587, 19961485, 22760778, 24180328, 24413734, 25310466, 25337257, 25382608, 26574844, 26719098, 27983760, 28622960, 29100307, 29662631, 30782609, 31394087 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	17982880, 26746182, 31299121		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety disorder	Pubtator	26746182, 32361414	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	17982880, 26746182, 31299121, 31733039		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	23937241		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	15153662, 15372109, 22153699, 24668187, 30805961		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	9788887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	27665476		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asperger Syndrome	Asperger Syndrome	BEFREE	16419094		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	10641565, 10673365, 10833424, 11112111, 11668616, 12911502, 14767694, 15080837, 16238787, 17177683, 17351927, 17536218, 18086269, 18384429, 19603529 View all (7 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	LHGDN	11668616, 17536218		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	22591701, 23517041, 26587832, 34762840	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	28801347, 29552127, 30279958, 30611004		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	15153662, 22153699, 24668187, 30805961		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	24622112	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	34428251	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	28589541, 33724699	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	21724667, 22939004, 26233433, 26821215		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	18563708		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	12757358, 16761297, 22892527, 24130822, 9809261		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	19635578, 28374504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	25696840		★★★★★ ★☆☆☆☆ Found in Text Mining only
Becker Muscular Dystrophy	Becker Muscular Dystrophy	BEFREE	16718354		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bedwetting	Nocturnal enuresis	BEFREE	17365914		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bedwetting	Nocturnal enuresis	LHGDN	17365914		★★★★★ ★☆☆☆☆ Found in Text Mining only
Behavior Disorders	Behavior Disorders	CTD_human_DG	17426488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	15150612		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	18257968, 28195573	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	18392456	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	20645313, 22959237, 25939888, 28873468, 30274650, 31733039		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	16517187		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	BEFREE	29995175		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	10769672		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	15375508, 17047063, 28040796		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brittle diabetes	Brittle diabetes mellitus	CTD_human_DG	21666113		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchioloalveolar Adenocarcinoma	Lung adenocarcinoma	BEFREE	25684509		★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	29272887, 31738823		★★★★★ ★☆☆☆☆ Found in Text Mining only
Canavan Disease	Canavan Disease	BEFREE	20673702		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	27869735	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	16341146		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	16517187		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	15150612	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	33221754	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	10368118, 24463882		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	27041589	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	12123766		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	19430166, 19463074, 20179961, 27500977, 31672462		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	24622112	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	30015520		★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	15936309		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebellar Diseases	Cerebellar Diseases	CTD_human_DG	25511929		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	24082858	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	BEFREE	29940959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	Pubtator	29940959	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	11309529, 12123766, 22153699, 24668187		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular Disorders	BEFREE	19250061		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	30675209		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	30675209		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	BEFREE	19657898		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	GWASCAT_DG	29551627		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	28290003		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Oligodendroglioma	Oligodendroglioma	BEFREE	28801347, 29470683		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholesteatoma	Cholesteatoma	BEFREE	23832258		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	11071967, 11168974, 15840037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	11071967, 11168974		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Liver Failure	Liver failure	CTD_human_DG	15025246		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	12592345, 14574328		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	15257312, 28028030		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	LHGDN	12816735		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	24192154		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic schizophrenia	Schizophrenia	BEFREE	21281558		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic sinusitis	Sinusitis	BEFREE	21679499		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	15287858		★★★★★ ★☆☆☆☆ Found in Text Mining only
Clonic Seizures	Clonic Seizures	CTD_human_DG	8749039		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	21281558	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	21724667		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	31153640		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	27752924		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	15905073, 16937436, 27752924, 30679085		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	GWASCAT_DG	26151821, 29917119		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	GWASCAT_DG	26151821, 29917119		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	29074106	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	36299603	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Complex partial seizures	Seizure	CTD_human_DG	8749039		★★★★★ ★☆☆☆☆ Found in Text Mining only
Complex Partial Status Epilepticus	Status Epilepticus	CTD_human_DG	20149694		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cone-Rod Dystrophy 2	Cone-rod dystrophy	BEFREE	31349925		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital arteriovenous malformation	Congenital Arteriovenous Malformation	BEFREE	30544349		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	18541744, 21963832, 23770231, 30012866, 9809923		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	15150612		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	17287556, 29749487		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	17287556, 27995364, 29749487		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	34814316	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	24713495, 29749487		★★★★★ ★☆☆☆☆ Found in Text Mining only
Corticobasal degeneration	Corticobasal Degeneration	BEFREE	18042235		★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	21679499		★★★★★ ★☆☆☆☆ Found in Text Mining only
CREST Syndrome	CREST Syndrome	BEFREE	30980594		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	LHGDN	17466601		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	19635578, 23472658		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cyclical vomiting syndrome (disorder)	Cyclical Vomiting Syndrome	BEFREE	28684727		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	11112133, 11890749, 12064512, 12911502, 14760158, 16517573, 20028935		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	14760158	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Darier Disease	Darier disease	Pubtator	26440917	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	11297817		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	36334414	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depression, Neurotic	Mental Depression	CTD_human_DG	17854383		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	CTD_human_DG	17854383		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	20052609, 22959237, 22989585, 24917196, 27977470, 29074292, 29331597, 29749487		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	26746182	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Syndrome	Mental Depression	CTD_human_DG	17854383		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	25216799		★★★★★ ★☆☆☆☆ Found in Text Mining only
Deuteranomaly	Deuteranomaly	BEFREE	18042235		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	15777779		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	15777779		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	21300066	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	28076881	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	18465682, 19635578		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	CTD_human_DG	21666113		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Ketosis-Prone	Diabetes Mellitus	CTD_human_DG	21666113		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	31607476		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Sudden-Onset	Diabetes Mellitus	CTD_human_DG	21666113		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes, Autoimmune	Autoimmune Diabetes	CTD_human_DG	21666113		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	19415232	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	19415232		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	16373702, 19423521, 22029677, 22967872, 28883511, 30306208, 30380402, 31150165, 31287335, 31533521		★★★★★ ★☆☆☆☆ Found in Text Mining only
Disruptive Impulse Control and Conduct Disorders	Disruptive, impulse control, and conduct disorders	Pubtator	21922604, 28589541, 32710539	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Disruptive, Impulse Control, and Conduct Disorders	Impulse control disorder	BEFREE	30813952		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	BEFREE	27431784		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysautonomia, Familial	Dysautonomia	BEFREE	24114042		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	25216799		★★★★★ ★☆☆☆☆ Found in Text Mining only
End Stage Liver Disease	End Stage Liver Disease	CTD_human_DG	15025246		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endogenous depression	Mental Depression	CTD_human_DG	17854383		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	16580392, 23935397		★★★★★ ★☆☆☆☆ Found in Text Mining only
Enteropathy-Associated T-Cell Lymphoma	Enteropathy-Associated T-Cell Lymphoma	BEFREE	22760778		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	28028030		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy Temporal Lobe	Temporal lobe epilepsy	Pubtator	12121328	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy, Frontal Lobe	Epilepsy	BEFREE	30366204		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	LHGDN	12686399		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epileptic drop attack	Hypotonic seizures	CTD_human_DG	8749039		★★★★★ ★☆☆☆☆ Found in Text Mining only
Erectile dysfunction	Erectile Dysfunction	BEFREE	15582286, 24897285, 27904147, 28218896, 29260891, 29736011		★★★★★ ★☆☆☆☆ Found in Text Mining only
Erectile Dysfunction	Erectile dysfunction	Pubtator	28076881, 28218896	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Achalasia	Achalasia	BEFREE	16848803, 25479138		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Achalasia	Achalasia	ORPHANET_DG	25479138		★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	9084930, 9298742		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fabry Disease	Fabry disease	BEFREE	29110178		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Fatigue syndrome	Pubtator	25853139	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	30559212		★★★★★ ★☆☆☆☆ Found in Text Mining only
Focal glomerulosclerosis	Glomerulosclerosis	BEFREE	31771524		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fragile X Syndrome	Fragile X Syndrome	BEFREE	22579290		★★★★★ ★☆☆☆☆ Found in Text Mining only
Frontotemporal Lobar Degeneration	Frontotemporal dementia	BEFREE	18042235		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fulminant Hepatic Failure with Cerebral Edema	Fulminant Hepatic Failure With Cerebral Edema	CTD_human_DG	10206825, 10564534		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fulminant hepatitis	Fulminant Hepatitis	BEFREE	27714757		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastroparesis	Gastroparesis	LHGDN	17161551		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastroparesis	Gastroparesis	Pubtator	21300066	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Generalized seizures	Seizure	CTD_human_DG	8749039		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	29552127, 7515942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	29552127, 7515942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	23259684, 23525950, 29470683		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	23259684, 23525950	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Grand Mal Status Epilepticus	Grand Mal Status Epilepticus	CTD_human_DG	20149694		★★★★★ ★☆☆☆☆ Found in Text Mining only
Headache	Headache	Pubtator	36292708	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	18541744, 23770231, 9809923		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemorrhoids	Hemorrhoids	BEFREE	30058493		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatic Coma	Hepatic Coma	CTD_human_DG	10206825, 10564534		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatic Encephalopathy	Hepatic Encephalopathy	CTD_human_DG	10206825, 10564534		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatic Stupor	Hepatic Stupor	CTD_human_DG	10206825, 10564534		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	28660626		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung Disease	BEFREE	9247233		★★★★★ ★☆☆☆☆ Found in Text Mining only
Histiocytosis haematophagic	Histiocytosis Haematophagic	BEFREE	24180328		★★★★★ ★☆☆☆☆ Found in Text Mining only
Holoprosencephaly	Holoprosencephaly	Pubtator	19234067	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	18329171		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperargininemia	Hyperbilirubinemia	Pubtator	9742507	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	30867247, 30987291		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	36292708	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	12788381, 22000010, 22049077, 22153699, 24713495, 28369791		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	14645200		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic achalasia of esophagus	Idiopathic achalasia	ORPHANET_DG	25479138		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Hypereosinophilic Syndrome	Hypereosinophilic Syndrome	BEFREE	21761433, 24577808, 26486351		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	31402164		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	29480750		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	21281558, 21724667, 22227051, 22579290		★★★★★ ★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	32344590	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	30679085		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	27761804		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Perforation	Intestinal Perforation	CTD_human_DG	18030227		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial aneurysm	Pubtator	29115560	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	29372479		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic cardiomyopathy	Ischemic myocardial dysfunction	BEFREE	27041589		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	24668187, 28346478, 28401316		★★★★★ ★☆☆☆☆ Found in Text Mining only
Jacksonian Seizure	Jacksonian Seizure	CTD_human_DG	8749039		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	23857971, 25382608, 29100307, 29898383, 9563791		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	28914438		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	11071967, 11168974, 15840037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	BEFREE	15150612		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	10918215, 11426546		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	20581309, 29455198, 30282643		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	23568283		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	24180328		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy Body Disease	BEFREE	11297817		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	23570557, 28660626, 31423564		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	15287858		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	BEFREE	28110436		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	12753090	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Long QT Syndrome	Long qt syndrome	Pubtator	23376825	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	9683299	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	23637325	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	23637325		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	LHGDN	15119548		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	20702104, 22760778, 23706909, 24180328, 30291111, 31484540		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	19423521	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	19423521		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	19423521		★★★★★ ★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	19836390	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	20016223, 26812915		★★★★★ ★☆☆☆☆ Found in Text Mining only
Male infertility with azoospermia or oligozoospermia due to single gene mutation	Male infertility	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Male infertility with teratozoospermia due to single gene mutation	Male Infertility With Teratozoospermia	ORPHANET_DG	23315541		★★★★★ ★☆☆☆☆ Found in Text Mining only
Male infertility with teratozoospermia due to single gene mutation	Male Infertility With Teratozoospermia	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Fibrous Histiocytoma	Malignant Histiocytoma	BEFREE	20368975		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	CTD_human_DG	25756049		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15375508, 17047063, 28040796, 9683299		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of large intestine	Colorectal Neoplasms	GWASCAT_DG	26151821, 29917119		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	10363563		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	21467233		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	19168583		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	16517187		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	14566822, 15375508, 15905073, 23009756, 25849745, 27140822, 28128734, 28660626, 29517684, 31629728		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	30675209		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	GWASCAT_DG	26151821, 29917119		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	31153640		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	15986128		★★★★★ ★☆☆☆☆ Found in Text Mining only
Manic	Manic Disorder	BEFREE	11843782, 28866717		★★★★★ ★☆☆☆☆ Found in Text Mining only
Marginal Zone B-Cell Lymphoma	B-Cell Lymphoma	BEFREE	24767771		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mastocytosis, Systemic	Mastocytosis	BEFREE	29025582		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mediastinal (Thymic) Large B-Cell Lymphoma	B-Cell Lymphoma	BEFREE	31150165		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	28290003		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melancholia	Melancholia	CTD_human_DG	17854383		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	24691438, 31805977		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	24691438	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	17328085	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Meniere Disease	Meniere Disease	BEFREE	21612410		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	20406964		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	20406964	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	20052609, 22959237, 22989585, 24917196, 27977470, 29074292, 29749487		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	CTD_human_DG	17426488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	21520349, 25612209		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Disorders, Severe	Mental Disorders	CTD_human_DG	17426488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	11424980, 16191396, 22937753, 26283425		★★★★★ ★☆☆☆☆ Found in Text Mining only
MILES-CARPENTER X-LINKED MENTAL RETARDATION SYNDROME	MILES-CARPENTER X-Linked MENTAL RETARDATION SYNDROME	BEFREE	25878398		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mixed anxiety and depressive disorder	Mixed Anxiety And Depressive Disorder	BEFREE	28465168		★★★★★ ★☆☆☆☆ Found in Text Mining only
mixed gliomas	Glioma	BEFREE	30279958		★★★★★ ★☆☆☆☆ Found in Text Mining only
MOHR-TRANEBJAERG SYNDROME	MOHR-TRANEBJAERG SYNDROME	BEFREE	30675218		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood disorder	Pubtator	18392456, 26440917	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	20016223, 25612209		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	38401491	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucinous Adenocarcinoma	Mucinous Adenocarcinoma	BEFREE	20191033		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucoepidermoid Carcinoma	Mucoepidermoid Carcinoma	BEFREE	23937241		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucopolysaccharidosis III	Mucopolysaccharidosis	Pubtator	29517684	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucosa-Associated Lymphoid Tissue Lymphoma	Mucosa-associated lymphoma	BEFREE	24767771		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	28671047		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	28671047	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	14759629, 23826716, 28299403		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	23826716	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	11087833, 22086232, 26437761	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	29703249	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	11745948, 19229108, 26604149, 30650618		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	20581309		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	19345314, 24806096, 28277146, 28608983		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	27041589, 30510628		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial ischemia	Pubtator	27041589	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	LHGDN	17924542		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	BEFREE	30463689		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myotonia Congenita	Myotonia congenita	Pubtator	22968481	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Type Extranodal NK/T-Cell Lymphoma	Extranodal NK T Cell Lymphoma	BEFREE	9563791		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	30911068		★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	23518680		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10769672, 16373702, 25216799, 27411305, 28162280, 28873352, 28903023, 28951270, 29649432, 30172956, 30194138, 30291111, 30420593, 30611004, 31015372, 31132432, 31805977, 8757334, 9328184 View all (4 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephritis, Interstitial	Nephritis	BEFREE	30409117		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephritis, Tubulointerstitial	Nephritis	BEFREE	30409117		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	29940959		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	CTD_human_DG	9495865		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural Tube Defect	BEFREE	24323870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	12753090, 17250678, 19726747, 9742507	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	16198233, 17417679, 18329171, 26458913, 7515942, 9742507		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	18663495, 32319615	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	27890696		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuromuscular Diseases	Neuromuscular Diseases	BEFREE	30066461		★★★★★ ★☆☆☆☆ Found in Text Mining only
NEUROTICISM	Neuroticism	BEFREE	22628180		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nodular Lymphocyte Predominant Hodgkin Lymphoma	Classical Hodgkin lymphoma	BEFREE	31287335		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Convulsive Status Epilepticus	Nonconvulsive status epilepticus	CTD_human_DG	20149694		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-obstructive azoospermia	Non-obstructive azoospermia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	22505743, 22862164, 23312886, 24079724, 29517684, 31810413		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	22797309, 24063765	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	28680351, 31672462		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obsessive-Compulsive Disorder	Obsessive-Compulsive Disorder	BEFREE	27739347		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obstructive azoospermia	Obstructive azoospermia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
oligodendroglioma	Oligodendroglioma	BEFREE	28801347, 29470683		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	31015372		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	32305006	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	21467233		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	21467233	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	28168994		★★★★★ ★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic Disorder	BEFREE	31733039		★★★★★ ★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic disorder	Pubtator	32361414	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Paranoid Disorders	Paranoia	Pubtator	18544180	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	11809160, 12490535, 15699372, 16934505, 18663495, 19326438, 26081147, 26383258, 27749554, 31041676, 9406918		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	18663495, 26383258, 32361414	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	CTD_human_DG	26383258		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	21161639, 30900515		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	30900515		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	16373702, 16676369, 17582237, 19074096, 19863542, 21887344, 21956856, 22760778, 22990019, 23857971, 24104394, 24413734, 25012943, 25310466, 25337257 View all (14 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Perivascular Epithelioid Cell Neoplasms	Perivascular Epithelioid Neoplasms	BEFREE	25621681		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pervasive Development Disorder	Autism spectrum disorder	BEFREE	16419094, 9809261		★★★★★ ★☆☆☆☆ Found in Text Mining only
Petit mal status	Petit Mal Status	CTD_human_DG	20149694		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic lipomembranous osteodysplasia with sclerosing leukoencephalopathy	Polycystic lipomembranous osteodysplasia with sclerosing leukoencephalopathy	Pubtator	21922604	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Portal Hypertension	Portal Hypertension	BEFREE	15287858		★★★★★ ★☆☆☆☆ Found in Text Mining only
Portal Hypertension	Portal Hypertension	LHGDN	15287858		★★★★★ ★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	28465168		★★★★★ ★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	11297817		★★★★★ ★☆☆☆☆ Found in Text Mining only
Priapism	Priapism	BEFREE	29394072		★★★★★ ★☆☆☆☆ Found in Text Mining only
Progressive supranuclear palsy	Progressive Supranuclear Palsy	BEFREE	18042235		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	19168583		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychotic disorders	Pubtator	16380905	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	36292708	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	19797159	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	22000010		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pyloric Stenosis, Hypertrophic	Congenital hypertrophic pyloric stenosis	BEFREE	19851341, 22008325, 8571963, 9354728		★★★★★ ★☆☆☆☆ Found in Text Mining only
Raynaud Disease	Raynaud disease	Pubtator	29698501	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Raynaud Phenomenon	Raynaud Phenomenon	BEFREE	29698501		★★★★★ ★☆☆☆☆ Found in Text Mining only
Recurrent depressive disorder	Mental Depression	BEFREE	20888049		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	15150612		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Newborn	Congenital alveolar dysplasia	BEFREE	24602444		★★★★★ ★☆☆☆☆ Found in Text Mining only
Restless Legs Syndrome	Restless Legs Syndrome	BEFREE	18058820, 25300364		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	18303411		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	24618610	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	19327239, 19635578		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	20368975		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	12140778, 15094474, 16380905, 16389274, 18544180, 19513863, 19805695, 20605417, 20645313, 21281558, 21520349, 21620982, 22227051, 24220657, 25490993 View all (7 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	LHGDN	12140778, 14623375, 15094474, 18544180		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	16380905, 18257968, 18544180, 21281558, 26440917	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	CTD_human_DG	18923069		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	GWASCAT_DG	26198764, 28991256, 30285260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Semantic Dementia	Semantic Dementia	BEFREE	29876259		★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	20237583, 26324446, 28110436		★★★★★ ★☆☆☆☆ Found in Text Mining only
Single Seizure	Seizure	CTD_human_DG	8749039		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	24010499	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	18651156, 24010499		★★★★★ ★☆☆☆☆ Found in Text Mining only
Smith-Lemli-Opitz Syndrome	Smith-Lemli-Opitz Syndrome	BEFREE	16761297		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spastic cerebral palsy	Spastic Cerebral Palsy	BEFREE	29257210		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spastic Quadriplegia	Spastic Quadriplegia	BEFREE	29940959		★★★★★ ★☆☆☆☆ Found in Text Mining only
SPERMATOGENIC FAILURE 12	Spermatogenic Failure	CTD_human_DG			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
SPERMATOGENIC FAILURE 12	Spermatogenic Failure	CLINVAR_DG			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Spinal Muscular Atrophy	Spinal Muscular Atrophy	BEFREE	29783125		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	32756061	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	CTD_human_DG	20149694		★★★★★ ★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	31047919, 31675604		★★★★★ ★☆☆☆☆ Found in Text Mining only
Status Epilepticus, Subclinical	Status Epilepticus	CTD_human_DG	20149694		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	30559212		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	15609395		★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	14632763		★★★★★ ★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	20702104, 25310466, 28340873, 30291111, 30952973		★★★★★ ★☆☆☆☆ Found in Text Mining only
T-Cell Prolymphocytic Leukemia	T-Cell Prolymphocytic Leukemia	BEFREE	26379148, 28129454		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	28089352		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tonic - clonic seizures	Seizure	CTD_human_DG	8749039		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	24969877, 29301832, 31642210		★★★★★ ★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	CTD_human_DG	17854383		★★★★★ ★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	20016223		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Incontinence Stress	Stress urinary incontinence	Pubtator	29900523	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urination Disorders	Urination Disorders	CTD_human_DG	9142130		★★★★★ ★☆☆☆☆ Found in Text Mining only
Varicosity	Vulval varices	BEFREE	30063800		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	11168974, 29110178		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	24063765	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Visual seizure	Seizure	CTD_human_DG	8749039		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitelliform Macular Dystrophy	Vitelliform Macular Dystrophy	BEFREE	16718354		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	29186858	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom`s Macroglobulinemia	BEFREE	24767771		★★★★★ ★☆☆☆☆ Found in Text Mining only
Well Differentiated Oligodendroglioma	Oligodendroglioma	BEFREE	28801347, 29470683		★★★★★ ★☆☆☆☆ Found in Text Mining only

NANOS1 (nanos C2HC-type zinc finger 1)