Gene Gene information from NCBI Gene database.
Entrez ID 340371
Gene name Nuclear receptor binding protein 2
Gene symbol NRBP2
Synonyms (NCBI Gene)
TRG16pp9320
Chromosome 8
Chromosome location 8q24.3
miRNA miRNA information provided by mirtarbase database.
198
miRTarBase ID miRNA Experiments Reference
MIRT1193703 hsa-miR-1 CLIP-seq
MIRT1193704 hsa-miR-1202 CLIP-seq
MIRT1193705 hsa-miR-1252 CLIP-seq
MIRT1193706 hsa-miR-1257 CLIP-seq
MIRT1193707 hsa-miR-1264 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
14
GO ID Ontology Definition Evidence Reference
GO:0004672 Function Protein kinase activity IEA
GO:0004674 Function Protein serine/threonine kinase activity IBA
GO:0005515 Function Protein binding IPI 25416956, 28514442, 32707033, 33961781
GO:0005524 Function ATP binding IEA
GO:0005737 Component Cytoplasm IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
615563 19339 ENSG00000185189
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9NSY0
Protein name Nuclear receptor-binding protein 2 (Transformation-related gene 16 protein) (TRG-16)
Protein function May regulate apoptosis of neural progenitor cells during their differentiation.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00069 Pkinase 56 306 Protein kinase domain Domain
Sequence
MAAPEPAPRRAREREREREDESEDESDILEESPCGRWQKRREQVNQGNMPGLQSTFLAMD
TEEGVEVVWNELHFGDRKAFAAHEEKIQTVFEQLVLVDHPNIVKLHKYWLDTSEACARVI
FITEYVSSGSLKQFLKKTKKNHKAMNARAWKRWCTQILSALSFLHACSPPIIHGNLTSDT
IFIQHNGLIKIGSVWHRIFSNALPDDLRSPIRAEREELRNLHFFPPEYGEVADGTAVDIF
SFGMCALEMAVLEIQTNGDTRVTEEAIARARHSLSDPNMREFILCCLARDPARRPSAHSL
LFHRVL
FEVHSLKLLAAHCFIQHQYLMPENVVEEKTKAMDLHAVLAELPRPRRPPLQWRY
SEVSFMELDKFLEDVRNGIYPLMNFAATRPLGLPRVLAPPPEEVQKAKTPTPEPFDSETR
KVIQMQCNLERSEDKARWHLTLLLVLEDRLHRQLTYDLLPTDSAQDLASELVHYGFLHED
DRMKLAAFLESTFLKYRGTQA
Sequence length 501
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
SCHIZOPHRENIA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Cardiomyopathy Dilated Dilated cardiomyopathy Pubtator 31009519 Associate
★☆☆☆☆
Found in Text Mining only
Childhood Medulloblastoma Medulloblastoma BEFREE 18619852
★☆☆☆☆
Found in Text Mining only
Congestive heart failure Congestive Heart Failure BEFREE 31009519
★☆☆☆☆
Found in Text Mining only
Growth Disorders Growth disorder Pubtator 30352594 Associate
★☆☆☆☆
Found in Text Mining only
Heart Diseases Heart disease Pubtator 31009519 Associate
★☆☆☆☆
Found in Text Mining only
Heart failure Heart Failure BEFREE 31009519
★☆☆☆☆
Found in Text Mining only
Intellectual Disability Intellectual developmental disorder Pubtator 30352594 Associate
★☆☆☆☆
Found in Text Mining only
Liver carcinoma Liver carcinoma BEFREE 27634758
★☆☆☆☆
Found in Text Mining only
Malignant Neoplasms Malignant Neoplasm BEFREE 27634758
★☆☆☆☆
Found in Text Mining only
Ventricular Dysfunction Left Ventricular dysfunction Pubtator 31009519 Associate
★☆☆☆☆
Found in Text Mining only