TSPAN33 (tetraspanin 33)

Gene

• Entrez ID: 340348
• Gene name: Tetraspanin 33
• Gene symbol: TSPAN33
• Synonyms (NCBI Gene): PEN, PEN., TSPAN-33
• Chromosome: 7
• Chromosome location: 7q32.1

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT047718	hsa-miR-10a-5p	CLASH	23622248
MIRT047482	hsa-miR-10b-5p	CLASH	23622248
MIRT042265	hsa-miR-484	CLASH	23622248
MIRT1459825	hsa-miR-1207-5p	CLIP-seq
MIRT1459826	hsa-miR-1265	CLIP-seq
MIRT1459827	hsa-miR-1286	CLIP-seq
MIRT1459828	hsa-miR-1471	CLIP-seq
MIRT1459829	hsa-miR-1908	CLIP-seq
MIRT1459830	hsa-miR-19a	CLIP-seq
MIRT1459831	hsa-miR-19b	CLIP-seq
MIRT1459832	hsa-miR-2392	CLIP-seq
MIRT1459833	hsa-miR-3128	CLIP-seq
MIRT1459834	hsa-miR-3192	CLIP-seq
MIRT1459835	hsa-miR-345	CLIP-seq
MIRT1459836	hsa-miR-34c-3p	CLIP-seq
MIRT1459837	hsa-miR-3605-5p	CLIP-seq
MIRT1459838	hsa-miR-3689a-3p	CLIP-seq
MIRT1459839	hsa-miR-3689c	CLIP-seq
MIRT1459840	hsa-miR-4436a	CLIP-seq
MIRT1459841	hsa-miR-4639-3p	CLIP-seq
MIRT1459842	hsa-miR-4714-5p	CLIP-seq
MIRT1459843	hsa-miR-4720-5p	CLIP-seq
MIRT1459844	hsa-miR-4726-3p	CLIP-seq
MIRT1459845	hsa-miR-4728-5p	CLIP-seq
MIRT1459846	hsa-miR-4736	CLIP-seq
MIRT1459847	hsa-miR-4738-5p	CLIP-seq
MIRT1459848	hsa-miR-4763-3p	CLIP-seq
MIRT1459849	hsa-miR-4799-3p	CLIP-seq
MIRT1459850	hsa-miR-486-3p	CLIP-seq
MIRT1459851	hsa-miR-505	CLIP-seq
MIRT1459852	hsa-miR-619	CLIP-seq
MIRT1459853	hsa-miR-663	CLIP-seq
MIRT1459854	hsa-miR-744	CLIP-seq
MIRT1459855	hsa-miR-891b	CLIP-seq
MIRT1555223	hsa-miR-1275	CLIP-seq
MIRT1555224	hsa-miR-3191	CLIP-seq
MIRT1555225	hsa-miR-4525	CLIP-seq
MIRT1555226	hsa-miR-4665-5p	CLIP-seq
MIRT1555227	hsa-miR-4723-5p	CLIP-seq
MIRT1555228	hsa-miR-625	CLIP-seq
MIRT2137983	hsa-miR-10a	CLIP-seq
MIRT2137984	hsa-miR-10b	CLIP-seq
MIRT2137985	hsa-miR-1237	CLIP-seq
MIRT2137986	hsa-miR-1247	CLIP-seq
MIRT2137987	hsa-miR-135a	CLIP-seq
MIRT2137988	hsa-miR-135b	CLIP-seq
MIRT2137989	hsa-miR-136	CLIP-seq
MIRT2137990	hsa-miR-1910	CLIP-seq
MIRT1459830	hsa-miR-19a	CLIP-seq
MIRT1459831	hsa-miR-19b	CLIP-seq
MIRT2137991	hsa-miR-200b	CLIP-seq
MIRT2137992	hsa-miR-200c	CLIP-seq
MIRT2137993	hsa-miR-24	CLIP-seq
MIRT2137994	hsa-miR-3150b-3p	CLIP-seq
MIRT2137995	hsa-miR-3156-3p	CLIP-seq
MIRT2137996	hsa-miR-3670	CLIP-seq
MIRT2137997	hsa-miR-3685	CLIP-seq
MIRT2137998	hsa-miR-3907	CLIP-seq
MIRT2137999	hsa-miR-4264	CLIP-seq
MIRT2138000	hsa-miR-4284	CLIP-seq
MIRT2138001	hsa-miR-429	CLIP-seq
MIRT2138002	hsa-miR-4301	CLIP-seq
MIRT2138003	hsa-miR-4449	CLIP-seq
MIRT2138004	hsa-miR-455-3p	CLIP-seq
MIRT1459847	hsa-miR-4738-5p	CLIP-seq
MIRT2138005	hsa-miR-4784	CLIP-seq
MIRT2138006	hsa-miR-485-5p	CLIP-seq
MIRT2138007	hsa-miR-516b	CLIP-seq
MIRT1459855	hsa-miR-891b	CLIP-seq
MIRT2358909	hsa-miR-138	CLIP-seq
MIRT2358910	hsa-miR-3130-3p	CLIP-seq
MIRT2358911	hsa-miR-323-5p	CLIP-seq
MIRT2358912	hsa-miR-34a	CLIP-seq
MIRT2358913	hsa-miR-34c-5p	CLIP-seq
MIRT2358914	hsa-miR-4266	CLIP-seq
MIRT2358915	hsa-miR-4279	CLIP-seq
MIRT2358916	hsa-miR-4456	CLIP-seq
MIRT2358917	hsa-miR-4487	CLIP-seq
MIRT2358918	hsa-miR-4488	CLIP-seq
MIRT2358919	hsa-miR-449a	CLIP-seq
MIRT2358920	hsa-miR-449b	CLIP-seq
MIRT2358921	hsa-miR-4694-5p	CLIP-seq
MIRT2358922	hsa-miR-4697-5p	CLIP-seq
MIRT2358923	hsa-miR-4793-3p	CLIP-seq
MIRT2358924	hsa-miR-515-3p	CLIP-seq
MIRT2358925	hsa-miR-519e	CLIP-seq
MIRT2358926	hsa-miR-609	CLIP-seq
MIRT2358927	hsa-miR-876-3p	CLIP-seq
MIRT1459830	hsa-miR-19a	CLIP-seq
MIRT1459831	hsa-miR-19b	CLIP-seq
MIRT2396422	hsa-miR-2355-3p	CLIP-seq
MIRT2396423	hsa-miR-4646-3p	CLIP-seq
MIRT1459847	hsa-miR-4738-5p	CLIP-seq
MIRT1459855	hsa-miR-891b	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	23091066, 26686862, 30463011, 32296183, 32814053
GO:0005737	Component	Cytoplasm	IEA
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	23091066
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005912	Component	Adherens junction	IEA
GO:0009986	Component	Cell surface	IEA
GO:0016020	Component	Membrane	IEA
GO:0019899	Function	Enzyme binding	IEA
GO:0019899	Function	Enzyme binding	IPI	23091066
GO:0046930	Component	Pore complex	IEA
GO:0046930	Component	Pore complex	IMP	30463011
GO:0046931	Process	Pore complex assembly	IEA
GO:0046931	Process	Pore complex assembly	IMP	30463011
GO:0051604	Process	Protein maturation	IBA
GO:0051604	Process	Protein maturation	IDA	23091066
GO:0051604	Process	Protein maturation	IEA
GO:0070161	Component	Anchoring junction	IEA
GO:0072659	Process	Protein localization to plasma membrane	IBA
GO:0072659	Process	Protein localization to plasma membrane	IDA	23091066
GO:0072659	Process	Protein localization to plasma membrane	IEA
GO:0097197	Component	Tetraspanin-enriched microdomain	IEA

Other IDs

• MIM: 610120
• HGNC: 28743
• e!Ensembl: ENSG00000158457

Protein

• UniProt ID: Q86UF1
• Protein name: Tetraspanin-33 (Tspan-33) (Penumbra) (hPen) (Proerythroblast new membrane)
• Protein function: Part of TspanC8 subgroup, composed of 6 members that interact with the transmembrane metalloprotease ADAM10. This interaction is required for ADAM10 exit from the endoplasmic reticulum and for enzymatic maturation and trafficking to the cell sur
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00335	Tetraspanin	22 → 263	Tetraspanin family	Family

• Tissue specificity: TISSUE SPECIFICITY: Predominantly expressed in erythroblasts. {ECO:0000269|PubMed:17158226}.
• Sequence:

  MARRPRAPAASGEEFSFVSPLVKYLLFFFNMLFWVISMVMVAVGVYARLMKHAEAALACL
  AVDPAILLIVVGVLMFLLTFCGCIGSLRENICLLQTFSLCLTAVFLLQLAAGILGFVFSD
  KARGKVSEIINNAIVHYRDDLDLQNLIDFGQKKFSCCGGISYKDWSQNMYFNCSEDNPSR
  ERCSVPYSCCLPTPDQAVINTMCGQGMQAFDYLEASKVIYTNGCIDKLVNWIHSNLFLLG
  GVALGLAIPQLVGILLSQILVNQIKDQIKLQLYNQQHRADPWY

• Sequence length: 283

Pathways

Reactome:

Amyloid fiber formation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Cerebrovascular Accidents	Stroke	BEFREE	16132618, 16651816, 20175862, 27466373, 29674752, 30010229, 30742037, 30803332, 30936686, 30937950, 31344491, 31455665		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	24211713		★☆☆☆☆ Found in Text Mining only
Adult Oligodendroglioma	Oligodendroglioma	BEFREE	25249434		★☆☆☆☆ Found in Text Mining only
Androgen-Insensitivity Syndrome	Androgen-Insensitivity Syndrome	BEFREE	29399075, 29513676, 31485869		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	17158226		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	29554859		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	24211713		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	24211713		★☆☆☆☆ Found in Text Mining only
Brain Infarction	Brain Infarction	BEFREE	23559636, 30284460		★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	BEFREE	12511777, 12543276, 29205357		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	28678532		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	32526247	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	31526257		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	19650809, 22833359, 27501802, 28982330, 29299743, 30068479, 30572437, 30797872, 30841779, 31531392		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	17053973, 17474298, 21167846, 21357744, 22381515, 23386126, 24043570, 27425766, 27796760, 27879370, 28188261, 28192195, 28479465, 28487326, 28687423, 28887396, 28929836, 28963051, 29188434, 29282332, 29370523, 29468175, 29674752, 29746644, 29949087, 30061367, 30354992, 30356889, 30496562, 30506268, 30690102, 30787398, 30935350, 30936686, 30937950, 31019105, 31132969, 31200484, 31208301, 31226451, 31449479, 31493239, 31496947, 31531392, 31846850		★☆☆☆☆ Found in Text Mining only
Childhood Oligodendroglioma	Oligodendroglioma	BEFREE	25249434		★☆☆☆☆ Found in Text Mining only
Common Migraine	Common Migraine	BEFREE	29459398		★☆☆☆☆ Found in Text Mining only
Deep Vein Thrombosis	Thrombosis	BEFREE	30639411		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	12511777		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	30121406		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	30121406		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	25201977	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	26611106, 30464772		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	24211713		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	25249434		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	26863628	Associate	★☆☆☆☆ Found in Text Mining only
Hyalinosis, Systemic	Hyalinosis	BEFREE	31083528		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	28675047		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	14983220, 16132618, 20175862, 21167846, 27846459, 27879370, 28523299, 28600481, 28687423, 28727192, 28864200, 28923277, 28929836, 29148900, 29370523, 29513676, 30447684, 30552877, 30641833, 30705295, 30936698, 31020007, 31037498, 31099185, 31297748, 31846850		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	17158226		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	24211713		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	24211713		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	28678532		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	31526257		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	16213355, 30857829		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	30319081		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	12511777		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	29459398, 31132969		★☆☆☆☆ Found in Text Mining only
Migraine with Aura	Migraine with Aura	BEFREE	29459398		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	17158226		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	40305362	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	25249434, 30735385, 31526257		★☆☆☆☆ Found in Text Mining only
Neuromyelitis Optica	Neuromyelitis Optica	BEFREE	24190619		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	31526257		★☆☆☆☆ Found in Text Mining only
oligodendroglioma	Oligodendroglioma	BEFREE	25249434		★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglosphonic dysplasia	BEFREE	31026065		★☆☆☆☆ Found in Text Mining only
Sinus Thrombosis, Intracranial	Sinus Thrombosis, Intracranial	BEFREE	29700217, 29794157		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	31649014		★☆☆☆☆ Found in Text Mining only
ST segment elevation myocardial infarction	ST Segment Elevation Myocardial Infarction	BEFREE	27846459		★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	30280591		★☆☆☆☆ Found in Text Mining only
Transient Cerebral Ischemia	Cerebral Ischemia	BEFREE	28192195		★☆☆☆☆ Found in Text Mining only
Transient Ischemic Attack	Transient Ischemic Attack	BEFREE	28192195		★☆☆☆☆ Found in Text Mining only
Well Differentiated Oligodendroglioma	Oligodendroglioma	BEFREE	25249434		★☆☆☆☆ Found in Text Mining only