Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	340168
Gene name	Developmental pluripotency associated 5
Gene symbol	DPPA5
Synonyms (NCBI Gene)	ESG1
Chromosome	6
Chromosome location	6q13
Summary	This gene encodes a protein that may function in the control of cell pluripotency and early embryogenesis. Expression of this gene is a specific marker for pluripotent stem cells. Pseudogenes of this gene are located on the short arm of chromosome 10 and

Show/Hide all (17)

miRTarBase ID	miRNA	Experiments
MIRT944403	hsa-miR-3148	CLIP-seq
MIRT944404	hsa-miR-3153	CLIP-seq
MIRT944405	hsa-miR-4668-5p	CLIP-seq
MIRT944406	hsa-miR-548c-3p	CLIP-seq
MIRT1556237	hsa-miR-548a-3p	CLIP-seq
MIRT1556238	hsa-miR-548e	CLIP-seq
MIRT1556239	hsa-miR-548f	CLIP-seq
MIRT1979629	hsa-miR-33a	CLIP-seq
MIRT1979630	hsa-miR-33b	CLIP-seq
MIRT1979631	hsa-miR-3652	CLIP-seq
MIRT1979632	hsa-miR-4261	CLIP-seq
MIRT1979633	hsa-miR-4430	CLIP-seq
MIRT1979634	hsa-miR-4505	CLIP-seq
MIRT1979635	hsa-miR-4738-3p	CLIP-seq
MIRT1979636	hsa-miR-582-3p	CLIP-seq
MIRT1979637	hsa-miR-647	CLIP-seq
MIRT1979638	hsa-miR-875-3p	CLIP-seq

Show/Hide all (7)

GO ID	Ontology	Definition	Evidence
GO:0003723	Function	RNA binding	IEA
GO:0003729	Function	MRNA binding	IBA
GO:0003729	Function	MRNA binding	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0010468	Process	Regulation of gene expression	IBA
GO:0010468	Process	Regulation of gene expression	IEA

MIM	HGNC	e!Ensembl
611111	19201	ENSG00000203909

A6NC42

Protein name

Developmental pluripotency-associated 5 protein (hDPPA5) (Embryonal stem cell-specific gene 1 protein) (ESG-1)

Protein function

Involved in the maintenance of embryonic stem (ES) cell pluripotency. Dispensable for self-renewal of pluripotent ES cells and establishment of germ cells. Associates with specific target mRNAs (By similarity).

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF16005	MOEP19	10 → 95	KH-like RNA-binding domain	Domain

Sequence

MGTLPARRHIPPWVKVPEDLKDPEVFQVQTRLLKAIFGPDGSRIPYIEQVSKAMLELKAL
ESSDLTEVVVYGSYLYKLRTKWMLQSMAEWHRQRQERGMLKLAEAMNALELGPWMK

Sequence length

116

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Aganglionic megacolon	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HIRSCHSPRUNG DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATIC FEVER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (1)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	29927686	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

DPPA5 (developmental pluripotency associated 5)