ID4 (inhibitor of DNA binding 4)

Gene

• Entrez ID: 3400
• Gene name: Inhibitor of DNA binding 4
• Gene symbol: ID4
• Synonyms (NCBI Gene): IDB4, bHLHb27
• Chromosome: 6
• Chromosome location: 6p22.3
• Summary: This gene encodes a member of the inhibitor of DNA binding (ID) protein family. The encoded protein lacks DNA binding ability, and instead regulates gene expression through binding to and inhibiting basic helix-loop-helix transcription factors. This prote

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT016169	hsa-miR-590-3p	Sequencing	20371350
MIRT018452	hsa-miR-335-5p	Reporter assay;Western blot;Other	21618216
MIRT019630	hsa-miR-340-5p	Sequencing	20371350
MIRT021484	hsa-miR-9-5p	Sequencing	20371350
MIRT022878	hsa-miR-124-3p	Microarray	18668037
MIRT026740	hsa-miR-192-5p	Sequencing	20371350
MIRT028697	hsa-miR-27a-3p	Sequencing	20371350
MIRT045037	hsa-miR-186-5p	CLASH	23622248
MIRT042873	hsa-miR-324-3p	CLASH	23622248
MIRT054884	hsa-miR-342-3p	Luciferase reporter assay, qRT-PCR, Western blot	24475217
MIRT645046	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT645045	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT645044	hsa-miR-432-5p	HITS-CLIP	23824327
MIRT645043	hsa-miR-3124-3p	HITS-CLIP	23824327
MIRT645042	hsa-miR-7111-3p	HITS-CLIP	23824327
MIRT645041	hsa-miR-6780a-3p	HITS-CLIP	23824327
MIRT645040	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT645039	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT645038	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT099567	hsa-miR-148a-5p	PAR-CLIP	20371350
MIRT016169	hsa-miR-590-3p	PAR-CLIP	20371350
MIRT572648	hsa-miR-4437	PAR-CLIP	20371350
MIRT572649	hsa-miR-4417	PAR-CLIP	20371350
MIRT572647	hsa-miR-4674	PAR-CLIP	20371350
MIRT572646	hsa-miR-4265	PAR-CLIP	20371350
MIRT572645	hsa-miR-4296	PAR-CLIP	20371350
MIRT572644	hsa-miR-4322	PAR-CLIP	20371350
MIRT572643	hsa-miR-6796-5p	PAR-CLIP	20371350
MIRT572642	hsa-miR-6759-5p	PAR-CLIP	20371350
MIRT099611	hsa-miR-548ae-3p	PAR-CLIP	20371350
MIRT099612	hsa-miR-548ah-3p	PAR-CLIP	20371350
MIRT099613	hsa-miR-548aj-3p	PAR-CLIP	20371350
MIRT099614	hsa-miR-548am-3p	PAR-CLIP	20371350
MIRT099617	hsa-miR-548aq-3p	PAR-CLIP	20371350
MIRT099604	hsa-miR-548j-3p	PAR-CLIP	20371350
MIRT099608	hsa-miR-548x-3p	PAR-CLIP	20371350
MIRT099601	hsa-miR-548a-3p	PAR-CLIP	20371350
MIRT099618	hsa-miR-548ar-3p	PAR-CLIP	20371350
MIRT099620	hsa-miR-548az-3p	PAR-CLIP	20371350
MIRT099603	hsa-miR-548e-3p	PAR-CLIP	20371350
MIRT099605	hsa-miR-548f-3p	PAR-CLIP	20371350
MIRT099596	hsa-miR-18a-5p	PAR-CLIP	20371350
MIRT099599	hsa-miR-18b-5p	PAR-CLIP	20371350
MIRT099616	hsa-miR-4735-3p	PAR-CLIP	20371350
MIRT317106	hsa-miR-223-5p	PAR-CLIP	20371350
MIRT317109	hsa-miR-7159-5p	PAR-CLIP	20371350
MIRT562151	hsa-miR-505-3p	PAR-CLIP	20371350
MIRT317107	hsa-miR-421	PAR-CLIP	20371350
MIRT099607	hsa-miR-3161	PAR-CLIP	20371350
MIRT317108	hsa-miR-1305	PAR-CLIP	20371350
MIRT099610	hsa-miR-548ac	PAR-CLIP	20371350
MIRT099623	hsa-miR-548bb-3p	PAR-CLIP	20371350
MIRT099602	hsa-miR-548d-3p	PAR-CLIP	20371350
MIRT099606	hsa-miR-548h-3p	PAR-CLIP	20371350
MIRT099609	hsa-miR-548z	PAR-CLIP	20371350
MIRT099611	hsa-miR-548ae-3p	PAR-CLIP	20371350
MIRT099612	hsa-miR-548ah-3p	PAR-CLIP	20371350
MIRT099613	hsa-miR-548aj-3p	PAR-CLIP	20371350
MIRT099614	hsa-miR-548am-3p	PAR-CLIP	20371350
MIRT099617	hsa-miR-548aq-3p	PAR-CLIP	20371350
MIRT099604	hsa-miR-548j-3p	PAR-CLIP	20371350
MIRT099608	hsa-miR-548x-3p	PAR-CLIP	20371350
MIRT512833	hsa-miR-548aa	PAR-CLIP	20371350
MIRT512832	hsa-miR-548ap-3p	PAR-CLIP	20371350
MIRT512831	hsa-miR-548t-3p	PAR-CLIP	20371350
MIRT099619	hsa-miR-548as-3p	PAR-CLIP	20371350
MIRT512830	hsa-miR-548at-3p	PAR-CLIP	20371350
MIRT512829	hsa-miR-548ay-3p	PAR-CLIP	20371350
MIRT099601	hsa-miR-548a-3p	PAR-CLIP	20371350
MIRT099618	hsa-miR-548ar-3p	PAR-CLIP	20371350
MIRT099620	hsa-miR-548az-3p	PAR-CLIP	20371350
MIRT099603	hsa-miR-548e-3p	PAR-CLIP	20371350
MIRT099605	hsa-miR-548f-3p	PAR-CLIP	20371350
MIRT099621	hsa-miR-6732-3p	PAR-CLIP	20371350
MIRT099597	hsa-miR-10a-5p	PAR-CLIP	20371350
MIRT099598	hsa-miR-10b-5p	PAR-CLIP	20371350
MIRT512828	hsa-miR-3163	PAR-CLIP	20371350
MIRT099600	hsa-miR-486-5p	PAR-CLIP	20371350
MIRT099610	hsa-miR-548ac	PAR-CLIP	20371350
MIRT099623	hsa-miR-548bb-3p	PAR-CLIP	20371350
MIRT099602	hsa-miR-548d-3p	PAR-CLIP	20371350
MIRT099606	hsa-miR-548h-3p	PAR-CLIP	20371350
MIRT099609	hsa-miR-548z	PAR-CLIP	20371350
MIRT099611	hsa-miR-548ae-3p	PAR-CLIP	20371350
MIRT099612	hsa-miR-548ah-3p	PAR-CLIP	20371350
MIRT099613	hsa-miR-548aj-3p	PAR-CLIP	20371350
MIRT099614	hsa-miR-548am-3p	PAR-CLIP	20371350
MIRT099617	hsa-miR-548aq-3p	PAR-CLIP	20371350
MIRT099604	hsa-miR-548j-3p	PAR-CLIP	20371350
MIRT099608	hsa-miR-548x-3p	PAR-CLIP	20371350
MIRT512833	hsa-miR-548aa	PAR-CLIP	20371350
MIRT512832	hsa-miR-548ap-3p	PAR-CLIP	20371350
MIRT512831	hsa-miR-548t-3p	PAR-CLIP	20371350
MIRT099619	hsa-miR-548as-3p	PAR-CLIP	20371350
MIRT512830	hsa-miR-548at-3p	PAR-CLIP	20371350
MIRT512829	hsa-miR-548ay-3p	PAR-CLIP	20371350
MIRT099601	hsa-miR-548a-3p	PAR-CLIP	20371350
MIRT099618	hsa-miR-548ar-3p	PAR-CLIP	20371350
MIRT099620	hsa-miR-548az-3p	PAR-CLIP	20371350
MIRT099603	hsa-miR-548e-3p	PAR-CLIP	20371350
MIRT099605	hsa-miR-548f-3p	PAR-CLIP	20371350
MIRT099596	hsa-miR-18a-5p	PAR-CLIP	20371350
MIRT099599	hsa-miR-18b-5p	PAR-CLIP	20371350
MIRT099616	hsa-miR-4735-3p	PAR-CLIP	20371350
MIRT099615	hsa-miR-4704-5p	PAR-CLIP	20371350
MIRT099597	hsa-miR-10a-5p	PAR-CLIP	20371350
MIRT099598	hsa-miR-10b-5p	PAR-CLIP	20371350
MIRT099600	hsa-miR-486-5p	PAR-CLIP	20371350
MIRT317106	hsa-miR-223-5p	PAR-CLIP	20371350
MIRT317109	hsa-miR-7159-5p	PAR-CLIP	20371350
MIRT562151	hsa-miR-505-3p	PAR-CLIP	20371350
MIRT317107	hsa-miR-421	PAR-CLIP	20371350
MIRT099607	hsa-miR-3161	PAR-CLIP	20371350
MIRT317108	hsa-miR-1305	PAR-CLIP	20371350
MIRT567227	hsa-miR-6790-3p	PAR-CLIP	20371350
MIRT567226	hsa-miR-6821-3p	PAR-CLIP	20371350
MIRT026740	hsa-miR-192-5p	PAR-CLIP	20371350
MIRT567225	hsa-miR-215-5p	PAR-CLIP	20371350
MIRT099546	hsa-miR-4311	PAR-CLIP	20371350
MIRT099549	hsa-miR-3646	PAR-CLIP	20371350
MIRT562155	hsa-miR-1252-3p	PAR-CLIP	20371350
MIRT317103	hsa-miR-6082	PAR-CLIP	20371350
MIRT562154	hsa-miR-7849-3p	PAR-CLIP	20371350
MIRT099545	hsa-miR-3123	PAR-CLIP	20371350
MIRT019630	hsa-miR-340-5p	PAR-CLIP	20371350
MIRT562153	hsa-miR-513a-5p	PAR-CLIP	20371350
MIRT028697	hsa-miR-27a-3p	PAR-CLIP	20371350
MIRT562152	hsa-miR-27b-3p	PAR-CLIP	20371350
MIRT099552	hsa-miR-4709-3p	PAR-CLIP	20371350
MIRT257369	hsa-let-7c-3p	PAR-CLIP	20371350
MIRT257379	hsa-miR-3617-5p	PAR-CLIP	20371350
MIRT257376	hsa-miR-641	PAR-CLIP	20371350
MIRT257371	hsa-miR-181a-5p	PAR-CLIP	20371350
MIRT257372	hsa-miR-181b-5p	PAR-CLIP	20371350
MIRT257373	hsa-miR-181c-5p	PAR-CLIP	20371350
MIRT257375	hsa-miR-181d-5p	PAR-CLIP	20371350
MIRT257378	hsa-miR-4262	PAR-CLIP	20371350
MIRT018452	hsa-miR-335-5p	PAR-CLIP	20371350
MIRT257374	hsa-miR-144-5p	PAR-CLIP	20371350
MIRT099610	hsa-miR-548ac	PAR-CLIP	20371350
MIRT099623	hsa-miR-548bb-3p	PAR-CLIP	20371350
MIRT099602	hsa-miR-548d-3p	PAR-CLIP	20371350
MIRT099606	hsa-miR-548h-3p	PAR-CLIP	20371350
MIRT099609	hsa-miR-548z	PAR-CLIP	20371350
MIRT099611	hsa-miR-548ae-3p	PAR-CLIP	20371350
MIRT099612	hsa-miR-548ah-3p	PAR-CLIP	20371350
MIRT099613	hsa-miR-548aj-3p	PAR-CLIP	20371350
MIRT099614	hsa-miR-548am-3p	PAR-CLIP	20371350
MIRT099617	hsa-miR-548aq-3p	PAR-CLIP	20371350
MIRT099604	hsa-miR-548j-3p	PAR-CLIP	20371350
MIRT099608	hsa-miR-548x-3p	PAR-CLIP	20371350
MIRT512833	hsa-miR-548aa	PAR-CLIP	20371350
MIRT512832	hsa-miR-548ap-3p	PAR-CLIP	20371350
MIRT512831	hsa-miR-548t-3p	PAR-CLIP	20371350
MIRT099619	hsa-miR-548as-3p	PAR-CLIP	20371350
MIRT512830	hsa-miR-548at-3p	PAR-CLIP	20371350
MIRT512829	hsa-miR-548ay-3p	PAR-CLIP	20371350
MIRT099601	hsa-miR-548a-3p	PAR-CLIP	20371350
MIRT099618	hsa-miR-548ar-3p	PAR-CLIP	20371350
MIRT099620	hsa-miR-548az-3p	PAR-CLIP	20371350
MIRT099603	hsa-miR-548e-3p	PAR-CLIP	20371350
MIRT099605	hsa-miR-548f-3p	PAR-CLIP	20371350
MIRT099621	hsa-miR-6732-3p	PAR-CLIP	20371350
MIRT099596	hsa-miR-18a-5p	PAR-CLIP	20371350
MIRT099599	hsa-miR-18b-5p	PAR-CLIP	20371350
MIRT099616	hsa-miR-4735-3p	PAR-CLIP	20371350
MIRT099615	hsa-miR-4704-5p	PAR-CLIP	20371350
MIRT099597	hsa-miR-10a-5p	PAR-CLIP	20371350
MIRT099598	hsa-miR-10b-5p	PAR-CLIP	20371350
MIRT512828	hsa-miR-3163	PAR-CLIP	20371350
MIRT099600	hsa-miR-486-5p	PAR-CLIP	20371350
MIRT317106	hsa-miR-223-5p	PAR-CLIP	20371350
MIRT317109	hsa-miR-7159-5p	PAR-CLIP	20371350
MIRT562151	hsa-miR-505-3p	PAR-CLIP	20371350
MIRT317107	hsa-miR-421	PAR-CLIP	20371350
MIRT099607	hsa-miR-3161	PAR-CLIP	20371350
MIRT317108	hsa-miR-1305	PAR-CLIP	20371350
MIRT512833	hsa-miR-548aa	PAR-CLIP	22012620
MIRT512832	hsa-miR-548ap-3p	PAR-CLIP	22012620
MIRT512831	hsa-miR-548t-3p	PAR-CLIP	22012620
MIRT099619	hsa-miR-548as-3p	PAR-CLIP	22012620
MIRT512830	hsa-miR-548at-3p	PAR-CLIP	22012620
MIRT512829	hsa-miR-548ay-3p	PAR-CLIP	22012620
MIRT099621	hsa-miR-6732-3p	PAR-CLIP	22012620
MIRT099615	hsa-miR-4704-5p	PAR-CLIP	22012620
MIRT099597	hsa-miR-10a-5p	PAR-CLIP	22012620
MIRT099598	hsa-miR-10b-5p	PAR-CLIP	22012620
MIRT512828	hsa-miR-3163	PAR-CLIP	22012620
MIRT099587	hsa-miR-5011-5p	PAR-CLIP	22012620
MIRT528048	hsa-miR-656-3p	PAR-CLIP	22012620
MIRT099594	hsa-miR-6504-3p	PAR-CLIP	22012620
MIRT099600	hsa-miR-486-5p	PAR-CLIP	22012620
MIRT099577	hsa-miR-190a-3p	PAR-CLIP	22012620
MIRT099610	hsa-miR-548ac	PAR-CLIP	23446348
MIRT099623	hsa-miR-548bb-3p	PAR-CLIP	23446348
MIRT099602	hsa-miR-548d-3p	PAR-CLIP	23446348
MIRT099606	hsa-miR-548h-3p	PAR-CLIP	23446348
MIRT099609	hsa-miR-548z	PAR-CLIP	23446348
MIRT099611	hsa-miR-548ae-3p	PAR-CLIP	23446348
MIRT099612	hsa-miR-548ah-3p	PAR-CLIP	23446348
MIRT099613	hsa-miR-548aj-3p	PAR-CLIP	23446348
MIRT099614	hsa-miR-548am-3p	PAR-CLIP	23446348
MIRT099617	hsa-miR-548aq-3p	PAR-CLIP	23446348
MIRT099604	hsa-miR-548j-3p	PAR-CLIP	23446348
MIRT099608	hsa-miR-548x-3p	PAR-CLIP	23446348
MIRT512833	hsa-miR-548aa	PAR-CLIP	23446348
MIRT512832	hsa-miR-548ap-3p	PAR-CLIP	23446348
MIRT512831	hsa-miR-548t-3p	PAR-CLIP	23446348
MIRT099619	hsa-miR-548as-3p	PAR-CLIP	23446348
MIRT512830	hsa-miR-548at-3p	PAR-CLIP	23446348
MIRT512829	hsa-miR-548ay-3p	PAR-CLIP	23446348
MIRT099601	hsa-miR-548a-3p	PAR-CLIP	23446348
MIRT099618	hsa-miR-548ar-3p	PAR-CLIP	23446348
MIRT099620	hsa-miR-548az-3p	PAR-CLIP	23446348
MIRT099603	hsa-miR-548e-3p	PAR-CLIP	23446348
MIRT099605	hsa-miR-548f-3p	PAR-CLIP	23446348
MIRT099621	hsa-miR-6732-3p	PAR-CLIP	23446348
MIRT099597	hsa-miR-10a-5p	PAR-CLIP	23446348
MIRT099598	hsa-miR-10b-5p	PAR-CLIP	23446348
MIRT512828	hsa-miR-3163	PAR-CLIP	23446348
MIRT099600	hsa-miR-486-5p	PAR-CLIP	23446348
MIRT733064	hsa-miR-188-5p	Luciferase reporter assay, qRT-PCR, Western blotting	31819510
MIRT645046	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT645045	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT645044	hsa-miR-432-5p	HITS-CLIP	23824327
MIRT645043	hsa-miR-3124-3p	HITS-CLIP	23824327
MIRT645042	hsa-miR-7111-3p	HITS-CLIP	23824327
MIRT645041	hsa-miR-6780a-3p	HITS-CLIP	23824327
MIRT645040	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT645039	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT645038	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT099567	hsa-miR-148a-5p	PAR-CLIP	20371350
MIRT016169	hsa-miR-590-3p	PAR-CLIP	20371350
MIRT572648	hsa-miR-4437	PAR-CLIP	20371350
MIRT572649	hsa-miR-4417	PAR-CLIP	20371350
MIRT572647	hsa-miR-4674	PAR-CLIP	20371350
MIRT572646	hsa-miR-4265	PAR-CLIP	20371350
MIRT572645	hsa-miR-4296	PAR-CLIP	20371350
MIRT572644	hsa-miR-4322	PAR-CLIP	20371350
MIRT572643	hsa-miR-6796-5p	PAR-CLIP	20371350
MIRT572642	hsa-miR-6759-5p	PAR-CLIP	20371350
MIRT099611	hsa-miR-548ae-3p	PAR-CLIP	20371350
MIRT099612	hsa-miR-548ah-3p	PAR-CLIP	20371350
MIRT099613	hsa-miR-548aj-3p	PAR-CLIP	20371350
MIRT099614	hsa-miR-548am-3p	PAR-CLIP	20371350
MIRT099617	hsa-miR-548aq-3p	PAR-CLIP	20371350
MIRT099604	hsa-miR-548j-3p	PAR-CLIP	20371350
MIRT099608	hsa-miR-548x-3p	PAR-CLIP	20371350
MIRT099601	hsa-miR-548a-3p	PAR-CLIP	20371350
MIRT099618	hsa-miR-548ar-3p	PAR-CLIP	20371350
MIRT099620	hsa-miR-548az-3p	PAR-CLIP	20371350
MIRT099603	hsa-miR-548e-3p	PAR-CLIP	20371350
MIRT099605	hsa-miR-548f-3p	PAR-CLIP	20371350
MIRT099596	hsa-miR-18a-5p	PAR-CLIP	20371350
MIRT099599	hsa-miR-18b-5p	PAR-CLIP	20371350
MIRT099616	hsa-miR-4735-3p	PAR-CLIP	20371350
MIRT317106	hsa-miR-223-5p	PAR-CLIP	20371350
MIRT317109	hsa-miR-7159-5p	PAR-CLIP	20371350
MIRT562151	hsa-miR-505-3p	PAR-CLIP	20371350
MIRT317107	hsa-miR-421	PAR-CLIP	20371350
MIRT099607	hsa-miR-3161	PAR-CLIP	20371350
MIRT317108	hsa-miR-1305	PAR-CLIP	20371350
MIRT099610	hsa-miR-548ac	PAR-CLIP	20371350
MIRT099623	hsa-miR-548bb-3p	PAR-CLIP	20371350
MIRT099602	hsa-miR-548d-3p	PAR-CLIP	20371350
MIRT099606	hsa-miR-548h-3p	PAR-CLIP	20371350
MIRT099609	hsa-miR-548z	PAR-CLIP	20371350
MIRT099611	hsa-miR-548ae-3p	PAR-CLIP	20371350
MIRT099612	hsa-miR-548ah-3p	PAR-CLIP	20371350
MIRT099613	hsa-miR-548aj-3p	PAR-CLIP	20371350
MIRT099614	hsa-miR-548am-3p	PAR-CLIP	20371350
MIRT099617	hsa-miR-548aq-3p	PAR-CLIP	20371350
MIRT099604	hsa-miR-548j-3p	PAR-CLIP	20371350
MIRT099608	hsa-miR-548x-3p	PAR-CLIP	20371350
MIRT512833	hsa-miR-548aa	PAR-CLIP	20371350
MIRT512832	hsa-miR-548ap-3p	PAR-CLIP	20371350
MIRT512831	hsa-miR-548t-3p	PAR-CLIP	20371350
MIRT099619	hsa-miR-548as-3p	PAR-CLIP	20371350
MIRT512830	hsa-miR-548at-3p	PAR-CLIP	20371350
MIRT512829	hsa-miR-548ay-3p	PAR-CLIP	20371350
MIRT099601	hsa-miR-548a-3p	PAR-CLIP	20371350
MIRT099618	hsa-miR-548ar-3p	PAR-CLIP	20371350
MIRT099620	hsa-miR-548az-3p	PAR-CLIP	20371350
MIRT099603	hsa-miR-548e-3p	PAR-CLIP	20371350
MIRT099605	hsa-miR-548f-3p	PAR-CLIP	20371350
MIRT099621	hsa-miR-6732-3p	PAR-CLIP	20371350
MIRT099597	hsa-miR-10a-5p	PAR-CLIP	20371350
MIRT099598	hsa-miR-10b-5p	PAR-CLIP	20371350
MIRT512828	hsa-miR-3163	PAR-CLIP	20371350
MIRT099600	hsa-miR-486-5p	PAR-CLIP	20371350
MIRT099610	hsa-miR-548ac	PAR-CLIP	20371350
MIRT099623	hsa-miR-548bb-3p	PAR-CLIP	20371350
MIRT099602	hsa-miR-548d-3p	PAR-CLIP	20371350
MIRT099606	hsa-miR-548h-3p	PAR-CLIP	20371350
MIRT099609	hsa-miR-548z	PAR-CLIP	20371350
MIRT099611	hsa-miR-548ae-3p	PAR-CLIP	20371350
MIRT099612	hsa-miR-548ah-3p	PAR-CLIP	20371350
MIRT099613	hsa-miR-548aj-3p	PAR-CLIP	20371350
MIRT099614	hsa-miR-548am-3p	PAR-CLIP	20371350
MIRT099617	hsa-miR-548aq-3p	PAR-CLIP	20371350
MIRT099604	hsa-miR-548j-3p	PAR-CLIP	20371350
MIRT099608	hsa-miR-548x-3p	PAR-CLIP	20371350
MIRT512833	hsa-miR-548aa	PAR-CLIP	20371350
MIRT512832	hsa-miR-548ap-3p	PAR-CLIP	20371350
MIRT512831	hsa-miR-548t-3p	PAR-CLIP	20371350
MIRT099619	hsa-miR-548as-3p	PAR-CLIP	20371350
MIRT512830	hsa-miR-548at-3p	PAR-CLIP	20371350
MIRT512829	hsa-miR-548ay-3p	PAR-CLIP	20371350
MIRT099601	hsa-miR-548a-3p	PAR-CLIP	20371350
MIRT099618	hsa-miR-548ar-3p	PAR-CLIP	20371350
MIRT099620	hsa-miR-548az-3p	PAR-CLIP	20371350
MIRT099603	hsa-miR-548e-3p	PAR-CLIP	20371350
MIRT099605	hsa-miR-548f-3p	PAR-CLIP	20371350
MIRT099596	hsa-miR-18a-5p	PAR-CLIP	20371350
MIRT099599	hsa-miR-18b-5p	PAR-CLIP	20371350
MIRT099616	hsa-miR-4735-3p	PAR-CLIP	20371350
MIRT099615	hsa-miR-4704-5p	PAR-CLIP	20371350
MIRT099597	hsa-miR-10a-5p	PAR-CLIP	20371350
MIRT099598	hsa-miR-10b-5p	PAR-CLIP	20371350
MIRT099600	hsa-miR-486-5p	PAR-CLIP	20371350
MIRT317106	hsa-miR-223-5p	PAR-CLIP	20371350
MIRT317109	hsa-miR-7159-5p	PAR-CLIP	20371350
MIRT562151	hsa-miR-505-3p	PAR-CLIP	20371350
MIRT317107	hsa-miR-421	PAR-CLIP	20371350
MIRT099607	hsa-miR-3161	PAR-CLIP	20371350
MIRT317108	hsa-miR-1305	PAR-CLIP	20371350
MIRT567227	hsa-miR-6790-3p	PAR-CLIP	20371350
MIRT567226	hsa-miR-6821-3p	PAR-CLIP	20371350
MIRT026740	hsa-miR-192-5p	PAR-CLIP	20371350
MIRT567225	hsa-miR-215-5p	PAR-CLIP	20371350
MIRT099546	hsa-miR-4311	PAR-CLIP	20371350
MIRT099549	hsa-miR-3646	PAR-CLIP	20371350
MIRT562155	hsa-miR-1252-3p	PAR-CLIP	20371350
MIRT317103	hsa-miR-6082	PAR-CLIP	20371350
MIRT562154	hsa-miR-7849-3p	PAR-CLIP	20371350
MIRT099545	hsa-miR-3123	PAR-CLIP	20371350
MIRT019630	hsa-miR-340-5p	PAR-CLIP	20371350
MIRT562153	hsa-miR-513a-5p	PAR-CLIP	20371350
MIRT028697	hsa-miR-27a-3p	PAR-CLIP	20371350
MIRT562152	hsa-miR-27b-3p	PAR-CLIP	20371350
MIRT099552	hsa-miR-4709-3p	PAR-CLIP	20371350
MIRT257369	hsa-let-7c-3p	PAR-CLIP	20371350
MIRT257379	hsa-miR-3617-5p	PAR-CLIP	20371350
MIRT257376	hsa-miR-641	PAR-CLIP	20371350
MIRT257371	hsa-miR-181a-5p	PAR-CLIP	20371350
MIRT257372	hsa-miR-181b-5p	PAR-CLIP	20371350
MIRT257373	hsa-miR-181c-5p	PAR-CLIP	20371350
MIRT257375	hsa-miR-181d-5p	PAR-CLIP	20371350
MIRT257378	hsa-miR-4262	PAR-CLIP	20371350
MIRT018452	hsa-miR-335-5p	PAR-CLIP	20371350
MIRT257374	hsa-miR-144-5p	PAR-CLIP	20371350
MIRT099610	hsa-miR-548ac	PAR-CLIP	20371350
MIRT099623	hsa-miR-548bb-3p	PAR-CLIP	20371350
MIRT099602	hsa-miR-548d-3p	PAR-CLIP	20371350
MIRT099606	hsa-miR-548h-3p	PAR-CLIP	20371350
MIRT099609	hsa-miR-548z	PAR-CLIP	20371350
MIRT099611	hsa-miR-548ae-3p	PAR-CLIP	20371350
MIRT099612	hsa-miR-548ah-3p	PAR-CLIP	20371350
MIRT099613	hsa-miR-548aj-3p	PAR-CLIP	20371350
MIRT099614	hsa-miR-548am-3p	PAR-CLIP	20371350
MIRT099617	hsa-miR-548aq-3p	PAR-CLIP	20371350
MIRT099604	hsa-miR-548j-3p	PAR-CLIP	20371350
MIRT099608	hsa-miR-548x-3p	PAR-CLIP	20371350
MIRT512833	hsa-miR-548aa	PAR-CLIP	20371350
MIRT512832	hsa-miR-548ap-3p	PAR-CLIP	20371350
MIRT512831	hsa-miR-548t-3p	PAR-CLIP	20371350
MIRT099619	hsa-miR-548as-3p	PAR-CLIP	20371350
MIRT512830	hsa-miR-548at-3p	PAR-CLIP	20371350
MIRT512829	hsa-miR-548ay-3p	PAR-CLIP	20371350
MIRT099601	hsa-miR-548a-3p	PAR-CLIP	20371350
MIRT099618	hsa-miR-548ar-3p	PAR-CLIP	20371350
MIRT099620	hsa-miR-548az-3p	PAR-CLIP	20371350
MIRT099603	hsa-miR-548e-3p	PAR-CLIP	20371350
MIRT099605	hsa-miR-548f-3p	PAR-CLIP	20371350
MIRT099621	hsa-miR-6732-3p	PAR-CLIP	20371350
MIRT099596	hsa-miR-18a-5p	PAR-CLIP	20371350
MIRT099599	hsa-miR-18b-5p	PAR-CLIP	20371350
MIRT099616	hsa-miR-4735-3p	PAR-CLIP	20371350
MIRT099615	hsa-miR-4704-5p	PAR-CLIP	20371350
MIRT099597	hsa-miR-10a-5p	PAR-CLIP	20371350
MIRT099598	hsa-miR-10b-5p	PAR-CLIP	20371350
MIRT512828	hsa-miR-3163	PAR-CLIP	20371350
MIRT099600	hsa-miR-486-5p	PAR-CLIP	20371350
MIRT317106	hsa-miR-223-5p	PAR-CLIP	20371350
MIRT317109	hsa-miR-7159-5p	PAR-CLIP	20371350
MIRT562151	hsa-miR-505-3p	PAR-CLIP	20371350
MIRT317107	hsa-miR-421	PAR-CLIP	20371350
MIRT099607	hsa-miR-3161	PAR-CLIP	20371350
MIRT317108	hsa-miR-1305	PAR-CLIP	20371350
MIRT512833	hsa-miR-548aa	PAR-CLIP	22012620
MIRT512832	hsa-miR-548ap-3p	PAR-CLIP	22012620
MIRT512831	hsa-miR-548t-3p	PAR-CLIP	22012620
MIRT099619	hsa-miR-548as-3p	PAR-CLIP	22012620
MIRT512830	hsa-miR-548at-3p	PAR-CLIP	22012620
MIRT512829	hsa-miR-548ay-3p	PAR-CLIP	22012620
MIRT099621	hsa-miR-6732-3p	PAR-CLIP	22012620
MIRT099615	hsa-miR-4704-5p	PAR-CLIP	22012620
MIRT099597	hsa-miR-10a-5p	PAR-CLIP	22012620
MIRT099598	hsa-miR-10b-5p	PAR-CLIP	22012620
MIRT512828	hsa-miR-3163	PAR-CLIP	22012620
MIRT099587	hsa-miR-5011-5p	PAR-CLIP	22012620
MIRT528048	hsa-miR-656-3p	PAR-CLIP	22012620
MIRT099594	hsa-miR-6504-3p	PAR-CLIP	22012620
MIRT099600	hsa-miR-486-5p	PAR-CLIP	22012620
MIRT099577	hsa-miR-190a-3p	PAR-CLIP	22012620
MIRT099610	hsa-miR-548ac	PAR-CLIP	23446348
MIRT099623	hsa-miR-548bb-3p	PAR-CLIP	23446348
MIRT099602	hsa-miR-548d-3p	PAR-CLIP	23446348
MIRT099606	hsa-miR-548h-3p	PAR-CLIP	23446348
MIRT099609	hsa-miR-548z	PAR-CLIP	23446348
MIRT099611	hsa-miR-548ae-3p	PAR-CLIP	23446348
MIRT099612	hsa-miR-548ah-3p	PAR-CLIP	23446348
MIRT099613	hsa-miR-548aj-3p	PAR-CLIP	23446348
MIRT099614	hsa-miR-548am-3p	PAR-CLIP	23446348
MIRT099617	hsa-miR-548aq-3p	PAR-CLIP	23446348
MIRT099604	hsa-miR-548j-3p	PAR-CLIP	23446348
MIRT099608	hsa-miR-548x-3p	PAR-CLIP	23446348
MIRT512833	hsa-miR-548aa	PAR-CLIP	23446348
MIRT512832	hsa-miR-548ap-3p	PAR-CLIP	23446348
MIRT512831	hsa-miR-548t-3p	PAR-CLIP	23446348
MIRT099619	hsa-miR-548as-3p	PAR-CLIP	23446348
MIRT512830	hsa-miR-548at-3p	PAR-CLIP	23446348
MIRT512829	hsa-miR-548ay-3p	PAR-CLIP	23446348
MIRT099601	hsa-miR-548a-3p	PAR-CLIP	23446348
MIRT099618	hsa-miR-548ar-3p	PAR-CLIP	23446348
MIRT099620	hsa-miR-548az-3p	PAR-CLIP	23446348
MIRT099603	hsa-miR-548e-3p	PAR-CLIP	23446348
MIRT099605	hsa-miR-548f-3p	PAR-CLIP	23446348
MIRT099621	hsa-miR-6732-3p	PAR-CLIP	23446348
MIRT099597	hsa-miR-10a-5p	PAR-CLIP	23446348
MIRT099598	hsa-miR-10b-5p	PAR-CLIP	23446348
MIRT512828	hsa-miR-3163	PAR-CLIP	23446348
MIRT099600	hsa-miR-486-5p	PAR-CLIP	23446348
MIRT1059056	hsa-miR-192	CLIP-seq
MIRT1059057	hsa-miR-215	CLIP-seq
MIRT1549715	hsa-miR-1284	CLIP-seq
MIRT1549716	hsa-miR-21	CLIP-seq
MIRT1549717	hsa-miR-300	CLIP-seq
MIRT1549718	hsa-miR-338-5p	CLIP-seq
MIRT1549719	hsa-miR-380	CLIP-seq
MIRT1549720	hsa-miR-381	CLIP-seq
MIRT1549721	hsa-miR-3919	CLIP-seq
MIRT1549722	hsa-miR-4495	CLIP-seq
MIRT1549723	hsa-miR-4520a-3p	CLIP-seq
MIRT1549724	hsa-miR-4520b-3p	CLIP-seq
MIRT1549725	hsa-miR-4645-3p	CLIP-seq
MIRT1549726	hsa-miR-4666-3p	CLIP-seq
MIRT1549727	hsa-miR-4729	CLIP-seq
MIRT1549728	hsa-miR-4790-3p	CLIP-seq
MIRT1549729	hsa-miR-4803	CLIP-seq
MIRT1549730	hsa-miR-590-5p	CLIP-seq
MIRT1549731	hsa-miR-668	CLIP-seq
MIRT2245898	hsa-miR-101	CLIP-seq
MIRT2245899	hsa-miR-1252	CLIP-seq
MIRT2245900	hsa-miR-1273e	CLIP-seq
MIRT1549715	hsa-miR-1284	CLIP-seq
MIRT2245901	hsa-miR-144	CLIP-seq
MIRT2245902	hsa-miR-23a	CLIP-seq
MIRT2245903	hsa-miR-23b	CLIP-seq
MIRT2245904	hsa-miR-23c	CLIP-seq
MIRT2245905	hsa-miR-3130-3p	CLIP-seq
MIRT2245906	hsa-miR-3613-3p	CLIP-seq
MIRT2245907	hsa-miR-3668	CLIP-seq
MIRT2245908	hsa-miR-3941	CLIP-seq
MIRT2245909	hsa-miR-4422	CLIP-seq
MIRT2245910	hsa-miR-4457	CLIP-seq
MIRT1549722	hsa-miR-4495	CLIP-seq
MIRT2245911	hsa-miR-4509	CLIP-seq
MIRT2245912	hsa-miR-4635	CLIP-seq
MIRT2245913	hsa-miR-4643	CLIP-seq
MIRT2245914	hsa-miR-4659a-5p	CLIP-seq
MIRT2245915	hsa-miR-4659b-5p	CLIP-seq
MIRT2245916	hsa-miR-466	CLIP-seq
MIRT2245917	hsa-miR-4672	CLIP-seq
MIRT2245918	hsa-miR-4717-3p	CLIP-seq
MIRT2245919	hsa-miR-4744	CLIP-seq
MIRT2245920	hsa-miR-4776-3p	CLIP-seq
MIRT2245921	hsa-miR-4789-3p	CLIP-seq
MIRT2245922	hsa-miR-499-3p	CLIP-seq
MIRT2245923	hsa-miR-499a-3p	CLIP-seq
MIRT2245924	hsa-miR-513b	CLIP-seq
MIRT2245925	hsa-miR-548n	CLIP-seq
MIRT2245926	hsa-miR-548t	CLIP-seq
MIRT2245927	hsa-miR-561	CLIP-seq
MIRT2245928	hsa-miR-582-5p	CLIP-seq
MIRT2389234	hsa-miR-1238	CLIP-seq
MIRT2389235	hsa-miR-3183	CLIP-seq
MIRT2389236	hsa-miR-3673	CLIP-seq
MIRT2389237	hsa-miR-432	CLIP-seq
MIRT2389238	hsa-miR-4723-3p	CLIP-seq
MIRT2549001	hsa-miR-587	CLIP-seq
MIRT2549001	hsa-miR-587	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
SP1	Repression	9516472
SP3	Repression	9516472
USF1	Unknown	9516472

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000082	Process	G1/S transition of mitotic cell cycle	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	7665172
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0001649	Process	Osteoblast differentiation	IEA
GO:0002052	Process	Positive regulation of neuroblast proliferation	IEA
GO:0003714	Function	Transcription corepressor activity	IBA
GO:0005515	Function	Protein binding	IPI	17474147, 32814053
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IC	11136250
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0007405	Process	Neuroblast proliferation	IEA
GO:0007420	Process	Brain development	IEA
GO:0007623	Process	Circadian rhythm	IEA
GO:0008104	Process	Intracellular protein localization	IEA
GO:0008283	Process	Cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0021766	Process	Hippocampus development	IEA
GO:0021895	Process	Cerebral cortex neuron differentiation	IEA
GO:0021953	Process	Central nervous system neuron differentiation	IEA
GO:0022010	Process	Central nervous system myelination	IEA
GO:0030182	Process	Neuron differentiation	IBA
GO:0045444	Process	Fat cell differentiation	IEA
GO:0045599	Process	Negative regulation of fat cell differentiation	IEA
GO:0045665	Process	Negative regulation of neuron differentiation	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	11136250
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046983	Function	Protein dimerization activity	IEA
GO:0048708	Process	Astrocyte differentiation	IEA
GO:0048709	Process	Oligodendrocyte differentiation	IEA
GO:0048712	Process	Negative regulation of astrocyte differentiation	IEA
GO:0048715	Process	Negative regulation of oligodendrocyte differentiation	IEA
GO:0060512	Process	Prostate gland morphogenesis	IEA
GO:0060740	Process	Prostate gland epithelium morphogenesis	IEA
GO:0060741	Process	Prostate gland stromal morphogenesis	IEA
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IEA
GO:0061682	Process	Seminal vesicle morphogenesis	IEA
GO:0140416	Function	Transcription regulator inhibitor activity	IDA	7665172

Other IDs

• MIM: 600581
• HGNC: 5363
• e!Ensembl: ENSG00000172201

Protein

• UniProt ID: P47928
• Protein name: DNA-binding protein inhibitor ID-4 (Class B basic helix-loop-helix protein 27) (bHLHb27) (Inhibitor of DNA binding 4) (Inhibitor of differentiation 4)
• Protein function: Transcriptional regulator (lacking a basic DNA binding domain) which negatively regulates the basic helix-loop-helix (bHLH) transcription factors by forming heterodimers and inhibiting their DNA binding and transcriptional activity. Implicated i
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00010	HLH	64 → 105	Helix-loop-helix DNA-binding domain	Domain

• Sequence:

  MKAVSPVRPSGRKAPSGCGGGELALRCLAEHGHSLGGSAAAAAAAAAARCKAAEAAADEP
  ALCLQCDMNDCYSRLRRLVPTIPPNKKVSKVEILQHVIDYILDLQLALETHPALLRQPPP
  PAPPHHPAGTCPAAPPRTPLTALNTDPAGAVNKQGDSILCR

• Sequence length: 161

Pathways

KEGG:

TGF-beta signaling pathway
Signaling pathways regulating pluripotency of stem cells

Reactome:

NGF-stimulated transcription

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHILDHOOD ONSET ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLESTASIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DESBUQUOIS SYNDROME	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PREECLAMPSIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY DENTAL CARIES	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute leukemia	Leukemia	BEFREE	25889027		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	14534543		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	27537399, 31847356		★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	Pubtator	29476661	Associate	★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	23613880		★☆☆☆☆ Found in Text Mining only
Anaplastic carcinoma	Anaplastic Carcinoma	CTD_human_DG	14633621		★☆☆☆☆ Found in Text Mining only
Aplastic Anemia	Aplastic anemia	BEFREE	25920536, 26228212		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	23613880, 9872455		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	23613880	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	15876350		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	LHGDN	15876350		★☆☆☆☆ Found in Text Mining only
Blast Crisis	Blast crisis	Pubtator	28452111	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	18676808		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	15897910, 22538771, 29921315		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	11136250, 16582598, 17998253, 18513385, 24475217, 26464711, 26610810, 28652379, 29921315, 30066902, 30139383	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	27302063	Inhibit	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	32054109	Stimulate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	26648013		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	18513385, 23342268, 24343358	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	CTD_human_DG	14633621		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma	Carcinoma	Pubtator	24718460	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma of bladder	Bladder carcinoma	BEFREE	15876350		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	31847356		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	31956659	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	20849603	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Spindle-Cell	Carcinoma	CTD_human_DG	14633621		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	33015184	Associate	★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	29805632		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	29805632		★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	CTD_human_DG	27989131		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	21098398		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	15569977		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	18575765		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	35656024	Associate	★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	21663940		★☆☆☆☆ Found in Text Mining only
Differentiated Thyroid Gland Carcinoma	Thyroid Carcinoma	BEFREE	30413933		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	23472165, 30010178	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	18676808, 23613880, 28327358		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	22380883, 23132729, 27852622	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	23613880, 28327358		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	21531766		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	22380883	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	12969807		★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	12032322, 22759382	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG	16367923		★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	34580317	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	15723065		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	31147526	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	19543515, 22647397, 24164743, 25889027, 31147526, 37895120	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	24810788		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	28143562		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	20849603	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	32003423	Inhibit	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	18513385	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	30066902	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	LHGDN	17510533		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	17510533	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	17510533	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	26648013		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15897910, 29921315		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	31847356		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	22896676		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	19500415, 23342267, 25115397, 25778840, 27487149, 28252832		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG	16367923		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	15876350		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19500415, 21531766, 23342267, 23613880, 25512197, 27537399, 31847356		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	29805632		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	18513385		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	24343358	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	25642713		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	25642713	Stimulate	★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	25889027, 26228212		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	25889027, 26228212, 28452111	Associate	★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	24343358	Stimulate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	14534543, 15569977, 15723065, 19500415, 22896676, 23342267, 25778840, 26648013, 28252832		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	22896676		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	12032322	Associate	★☆☆☆☆ Found in Text Mining only
Parakeratosis	Parakeratosis	BEFREE	21663940		★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	16575399	Associate	★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	LHGDN	12969807, 17940204		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	19500415, 23342267, 25115397, 25778840, 27487149, 28252832		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	16575399, 24122992, 24330748, 25778840	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	19500415, 23342267	Inhibit	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	21663940		★☆☆☆☆ Found in Text Mining only
Rett Syndrome	Rett Syndrome	BEFREE	16682435		★☆☆☆☆ Found in Text Mining only
Rett Syndrome	Rett Syndrome	LHGDN	16682435		★☆☆☆☆ Found in Text Mining only
Sporadic Breast Carcinoma	Breast Carcinoma	BEFREE	16582598		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	21663940		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG	16367923		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid Neoplasms	Thyroid cancer	Pubtator	24718460	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	25684485, 38188675	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	26259780, 29921315		★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	CTD_human_DG	14633621		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	15876350, 24577895	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	32368784	Associate	★☆☆☆☆ Found in Text Mining only