Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	3399
Gene name	Inhibitor of DNA binding 3
Gene symbol	ID3
Synonyms (NCBI Gene)	HEIR-1bHLHb25
Chromosome	1
Chromosome location	1p36.12
Summary	The protein encoded by this gene is a helix-loop-helix (HLH) protein that can form heterodimers with other HLH proteins. However, the encoded protein lacks a basic DNA-binding domain and therefore inhibits the DNA binding of any HLH protein with which it

216

Show/Hide all (216)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004740	hsa-miR-520h	MicroarrayqRT-PCR	19435428
MIRT022266	hsa-miR-124-3p	Microarray	18668037
MIRT657245	hsa-miR-634	HITS-CLIP	23824327
MIRT657244	hsa-miR-7151-5p	HITS-CLIP	23824327
MIRT657243	hsa-miR-205-3p	HITS-CLIP	23824327
MIRT657242	hsa-miR-4762-5p	HITS-CLIP	23824327
MIRT657241	hsa-miR-338-3p	HITS-CLIP	23824327
MIRT455442	hsa-miR-4476	PAR-CLIP	23592263
MIRT455441	hsa-miR-6876-5p	PAR-CLIP	23592263
MIRT455440	hsa-miR-5002-5p	PAR-CLIP	23592263
MIRT455439	hsa-miR-6513-3p	PAR-CLIP	23592263
MIRT455438	hsa-miR-665	PAR-CLIP	23592263
MIRT455437	hsa-miR-766-3p	PAR-CLIP	23592263
MIRT455436	hsa-miR-3925-3p	PAR-CLIP	23592263
MIRT455434	hsa-miR-7515	PAR-CLIP	23592263
MIRT455435	hsa-miR-6132	PAR-CLIP	23592263
MIRT455433	hsa-miR-6836-5p	PAR-CLIP	23592263
MIRT455432	hsa-miR-3202	PAR-CLIP	23592263
MIRT455431	hsa-miR-1207-5p	PAR-CLIP	23592263
MIRT455430	hsa-miR-4763-3p	PAR-CLIP	23592263
MIRT455429	hsa-miR-6721-5p	PAR-CLIP	23592263
MIRT455428	hsa-miR-4474-5p	PAR-CLIP	23592263
MIRT455427	hsa-miR-7855-5p	PAR-CLIP	23592263
MIRT455436	hsa-miR-3925-3p	PAR-CLIP	26701625
MIRT455428	hsa-miR-4474-5p	PAR-CLIP	26701625
MIRT455437	hsa-miR-766-3p	PAR-CLIP	26701625
MIRT657245	hsa-miR-634	HITS-CLIP	23824327
MIRT657244	hsa-miR-7151-5p	HITS-CLIP	23824327
MIRT657243	hsa-miR-205-3p	HITS-CLIP	23824327
MIRT657242	hsa-miR-4762-5p	HITS-CLIP	23824327
MIRT657241	hsa-miR-338-3p	HITS-CLIP	23824327
MIRT455442	hsa-miR-4476	PAR-CLIP	23592263
MIRT455441	hsa-miR-6876-5p	PAR-CLIP	23592263
MIRT455440	hsa-miR-5002-5p	PAR-CLIP	23592263
MIRT455439	hsa-miR-6513-3p	PAR-CLIP	23592263
MIRT455438	hsa-miR-665	PAR-CLIP	23592263
MIRT455437	hsa-miR-766-3p	PAR-CLIP	23592263
MIRT455436	hsa-miR-3925-3p	PAR-CLIP	23592263
MIRT455434	hsa-miR-7515	PAR-CLIP	23592263
MIRT455435	hsa-miR-6132	PAR-CLIP	23592263
MIRT455433	hsa-miR-6836-5p	PAR-CLIP	23592263
MIRT455432	hsa-miR-3202	PAR-CLIP	23592263
MIRT455431	hsa-miR-1207-5p	PAR-CLIP	23592263
MIRT455430	hsa-miR-4763-3p	PAR-CLIP	23592263
MIRT455429	hsa-miR-6721-5p	PAR-CLIP	23592263
MIRT455428	hsa-miR-4474-5p	PAR-CLIP	23592263
MIRT455427	hsa-miR-7855-5p	PAR-CLIP	23592263
MIRT1059008	hsa-miR-1180	CLIP-seq
MIRT1059009	hsa-miR-1228	CLIP-seq
MIRT1059010	hsa-miR-1270	CLIP-seq
MIRT1059011	hsa-miR-1275	CLIP-seq
MIRT1059012	hsa-miR-128	CLIP-seq
MIRT1059013	hsa-miR-185	CLIP-seq
MIRT1059014	hsa-miR-1910	CLIP-seq
MIRT1059015	hsa-miR-1972	CLIP-seq
MIRT1059016	hsa-miR-224	CLIP-seq
MIRT1059017	hsa-miR-2278	CLIP-seq
MIRT1059018	hsa-miR-27a	CLIP-seq
MIRT1059019	hsa-miR-27b	CLIP-seq
MIRT1059020	hsa-miR-29a	CLIP-seq
MIRT1059021	hsa-miR-29b	CLIP-seq
MIRT1059022	hsa-miR-29c	CLIP-seq
MIRT1059023	hsa-miR-3127-5p	CLIP-seq
MIRT1059024	hsa-miR-3163	CLIP-seq
MIRT1059025	hsa-miR-340	CLIP-seq
MIRT1059026	hsa-miR-342-5p	CLIP-seq
MIRT1059027	hsa-miR-3667-3p	CLIP-seq
MIRT1059028	hsa-miR-3692	CLIP-seq
MIRT1059029	hsa-miR-3918	CLIP-seq
MIRT1059030	hsa-miR-4259	CLIP-seq
MIRT1059031	hsa-miR-4260	CLIP-seq
MIRT1059032	hsa-miR-4300	CLIP-seq
MIRT1059033	hsa-miR-4306	CLIP-seq
MIRT1059034	hsa-miR-4531	CLIP-seq
MIRT1059035	hsa-miR-4532	CLIP-seq
MIRT1059036	hsa-miR-4644	CLIP-seq
MIRT1059037	hsa-miR-4650-5p	CLIP-seq
MIRT1059038	hsa-miR-4651	CLIP-seq
MIRT1059039	hsa-miR-4664-5p	CLIP-seq
MIRT1059040	hsa-miR-4665-5p	CLIP-seq
MIRT1059041	hsa-miR-4691-3p	CLIP-seq
MIRT1059042	hsa-miR-4709-3p	CLIP-seq
MIRT1059043	hsa-miR-4717-5p	CLIP-seq
MIRT1059044	hsa-miR-4722-5p	CLIP-seq
MIRT1059045	hsa-miR-4768-3p	CLIP-seq
MIRT1059046	hsa-miR-483-3p	CLIP-seq
MIRT1059047	hsa-miR-513a-5p	CLIP-seq
MIRT1059048	hsa-miR-561	CLIP-seq
MIRT1059049	hsa-miR-608	CLIP-seq
MIRT1059050	hsa-miR-615-5p	CLIP-seq
MIRT1059051	hsa-miR-620	CLIP-seq
MIRT1059052	hsa-miR-766	CLIP-seq
MIRT1059053	hsa-miR-769-5p	CLIP-seq
MIRT1059054	hsa-miR-889	CLIP-seq
MIRT1059055	hsa-miR-920	CLIP-seq
MIRT1059027	hsa-miR-3667-3p	CLIP-seq
MIRT1549714	hsa-miR-4632	CLIP-seq
MIRT1059008	hsa-miR-1180	CLIP-seq
MIRT2013769	hsa-miR-1181	CLIP-seq
MIRT2013770	hsa-miR-1207-3p	CLIP-seq
MIRT1059012	hsa-miR-128	CLIP-seq
MIRT2013771	hsa-miR-138	CLIP-seq
MIRT2013772	hsa-miR-149	CLIP-seq
MIRT1059014	hsa-miR-1910	CLIP-seq
MIRT2013773	hsa-miR-1915	CLIP-seq
MIRT1059015	hsa-miR-1972	CLIP-seq
MIRT1059018	hsa-miR-27a	CLIP-seq
MIRT1059019	hsa-miR-27b	CLIP-seq
MIRT1059020	hsa-miR-29a	CLIP-seq
MIRT1059021	hsa-miR-29b	CLIP-seq
MIRT1059022	hsa-miR-29c	CLIP-seq
MIRT2013774	hsa-miR-3064-5p	CLIP-seq
MIRT1059027	hsa-miR-3667-3p	CLIP-seq
MIRT1059030	hsa-miR-4259	CLIP-seq
MIRT1059032	hsa-miR-4300	CLIP-seq
MIRT2013775	hsa-miR-4435	CLIP-seq
MIRT2013776	hsa-miR-4456	CLIP-seq
MIRT2013777	hsa-miR-4514	CLIP-seq
MIRT1059035	hsa-miR-4532	CLIP-seq
MIRT2013778	hsa-miR-4645-5p	CLIP-seq
MIRT1059037	hsa-miR-4650-5p	CLIP-seq
MIRT2013779	hsa-miR-4673	CLIP-seq
MIRT2013780	hsa-miR-4692	CLIP-seq
MIRT1059043	hsa-miR-4717-5p	CLIP-seq
MIRT1059044	hsa-miR-4722-5p	CLIP-seq
MIRT2013781	hsa-miR-4726-3p	CLIP-seq
MIRT1059045	hsa-miR-4768-3p	CLIP-seq
MIRT2013782	hsa-miR-4794	CLIP-seq
MIRT1059047	hsa-miR-513a-5p	CLIP-seq
MIRT1059050	hsa-miR-615-5p	CLIP-seq
MIRT2013783	hsa-miR-760	CLIP-seq
MIRT1059052	hsa-miR-766	CLIP-seq
MIRT1059055	hsa-miR-920	CLIP-seq
MIRT1059023	hsa-miR-3127-5p	CLIP-seq
MIRT2245895	hsa-miR-3194-3p	CLIP-seq
MIRT1059029	hsa-miR-3918	CLIP-seq
MIRT2245896	hsa-miR-4267	CLIP-seq
MIRT1549714	hsa-miR-4632	CLIP-seq
MIRT2245897	hsa-miR-4642	CLIP-seq
MIRT1059008	hsa-miR-1180	CLIP-seq
MIRT2013769	hsa-miR-1181	CLIP-seq
MIRT2013770	hsa-miR-1207-3p	CLIP-seq
MIRT1059012	hsa-miR-128	CLIP-seq
MIRT2437689	hsa-miR-1299	CLIP-seq
MIRT2013771	hsa-miR-138	CLIP-seq
MIRT2013772	hsa-miR-149	CLIP-seq
MIRT1059014	hsa-miR-1910	CLIP-seq
MIRT2013773	hsa-miR-1915	CLIP-seq
MIRT1059015	hsa-miR-1972	CLIP-seq
MIRT1059018	hsa-miR-27a	CLIP-seq
MIRT1059019	hsa-miR-27b	CLIP-seq
MIRT1059020	hsa-miR-29a	CLIP-seq
MIRT1059021	hsa-miR-29b	CLIP-seq
MIRT1059022	hsa-miR-29c	CLIP-seq
MIRT2013774	hsa-miR-3064-5p	CLIP-seq
MIRT2437690	hsa-miR-3065-3p	CLIP-seq
MIRT2437691	hsa-miR-3193	CLIP-seq
MIRT2437692	hsa-miR-3689d	CLIP-seq
MIRT1059030	hsa-miR-4259	CLIP-seq
MIRT1059031	hsa-miR-4260	CLIP-seq
MIRT2013775	hsa-miR-4435	CLIP-seq
MIRT2013776	hsa-miR-4456	CLIP-seq
MIRT2013777	hsa-miR-4514	CLIP-seq
MIRT1059035	hsa-miR-4532	CLIP-seq
MIRT2013778	hsa-miR-4645-5p	CLIP-seq
MIRT1059037	hsa-miR-4650-5p	CLIP-seq
MIRT2013779	hsa-miR-4673	CLIP-seq
MIRT2013780	hsa-miR-4692	CLIP-seq
MIRT1059044	hsa-miR-4722-5p	CLIP-seq
MIRT2013781	hsa-miR-4726-3p	CLIP-seq
MIRT1059045	hsa-miR-4768-3p	CLIP-seq
MIRT2437693	hsa-miR-4782-5p	CLIP-seq
MIRT2013782	hsa-miR-4794	CLIP-seq
MIRT1059047	hsa-miR-513a-5p	CLIP-seq
MIRT2437694	hsa-miR-516b	CLIP-seq
MIRT1059050	hsa-miR-615-5p	CLIP-seq
MIRT2013783	hsa-miR-760	CLIP-seq
MIRT1059052	hsa-miR-766	CLIP-seq
MIRT1059011	hsa-miR-1275	CLIP-seq
MIRT1059026	hsa-miR-342-5p	CLIP-seq
MIRT1059038	hsa-miR-4651	CLIP-seq
MIRT1059039	hsa-miR-4664-5p	CLIP-seq
MIRT1059040	hsa-miR-4665-5p	CLIP-seq
MIRT1059049	hsa-miR-608	CLIP-seq
MIRT2013769	hsa-miR-1181	CLIP-seq
MIRT2013770	hsa-miR-1207-3p	CLIP-seq
MIRT1059009	hsa-miR-1228	CLIP-seq
MIRT1059011	hsa-miR-1275	CLIP-seq
MIRT1059012	hsa-miR-128	CLIP-seq
MIRT2013771	hsa-miR-138	CLIP-seq
MIRT2013772	hsa-miR-149	CLIP-seq
MIRT1059014	hsa-miR-1910	CLIP-seq
MIRT1059015	hsa-miR-1972	CLIP-seq
MIRT1059018	hsa-miR-27a	CLIP-seq
MIRT1059019	hsa-miR-27b	CLIP-seq
MIRT1059020	hsa-miR-29a	CLIP-seq
MIRT1059021	hsa-miR-29b	CLIP-seq
MIRT1059022	hsa-miR-29c	CLIP-seq
MIRT2013774	hsa-miR-3064-5p	CLIP-seq
MIRT1059026	hsa-miR-342-5p	CLIP-seq
MIRT1059032	hsa-miR-4300	CLIP-seq
MIRT2013775	hsa-miR-4435	CLIP-seq
MIRT2013776	hsa-miR-4456	CLIP-seq
MIRT1059037	hsa-miR-4650-5p	CLIP-seq
MIRT1059038	hsa-miR-4651	CLIP-seq
MIRT1059039	hsa-miR-4664-5p	CLIP-seq
MIRT1059040	hsa-miR-4665-5p	CLIP-seq
MIRT1059042	hsa-miR-4709-3p	CLIP-seq
MIRT1059043	hsa-miR-4717-5p	CLIP-seq
MIRT2013782	hsa-miR-4794	CLIP-seq
MIRT1059047	hsa-miR-513a-5p	CLIP-seq
MIRT1059049	hsa-miR-608	CLIP-seq
MIRT2013783	hsa-miR-760	CLIP-seq
MIRT1059052	hsa-miR-766	CLIP-seq
MIRT1059053	hsa-miR-769-5p	CLIP-seq
MIRT1059055	hsa-miR-920	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
PTTG1	Activation	16926250

Show/Hide all (38)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	TAS	25248477
GO:0001656	Process	Metanephros development	IEA
GO:0003714	Function	Transcription corepressor activity	IBA
GO:0005515	Function	Protein binding	IPI	18255255, 20211142, 20861012, 25416956, 25609649, 28514442, 31515488, 32296183, 32814053, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IC	14627819
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0006275	Process	Regulation of DNA replication	IEA
GO:0007417	Process	Central nervous system development	IEA
GO:0007507	Process	Heart development	IEA
GO:0007517	Process	Muscle organ development	IEA
GO:0007623	Process	Circadian rhythm	IEA
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0019904	Function	Protein domain specific binding	IEA
GO:0030182	Process	Neuron differentiation	IBA
GO:0030182	Process	Neuron differentiation	IEA
GO:0030855	Process	Epithelial cell differentiation	IEA
GO:0030903	Process	Notochord development	IEA
GO:0042476	Process	Odontogenesis	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0043425	Function	BHLH transcription factor binding	IEA
GO:0043433	Process	Negative regulation of DNA-binding transcription factor activity	IDA	14627819
GO:0045662	Process	Negative regulation of myoblast differentiation	IEA
GO:0045668	Process	Negative regulation of osteoblast differentiation	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	14627819
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0046983	Function	Protein dimerization activity	IEA
GO:0048511	Process	Rhythmic process	IEA
GO:0072750	Process	Cellular response to leptomycin B	IEA
GO:0140416	Function	Transcription regulator inhibitor activity	IEA
GO:0140416	Function	Transcription regulator inhibitor activity	TAS	25248477
GO:1901707	Function	Leptomycin B binding	IEA

MIM	HGNC	e!Ensembl
600277	5362	ENSG00000117318

Q02535

Protein name

DNA-binding protein inhibitor ID-3 (Class B basic helix-loop-helix protein 25) (bHLHb25) (Helix-loop-helix protein HEIR-1) (ID-like protein inhibitor HLH 1R21) (Inhibitor of DNA binding 3) (Inhibitor of differentiation 3)

Protein function

Transcriptional regulator (lacking a basic DNA binding domain) which negatively regulates the basic helix-loop-helix (bHLH) transcription factors by forming heterodimers and inhibiting their DNA binding and transcriptional activity. Implicated i

PDB

2LFH

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00010	HLH	40 → 81	Helix-loop-helix DNA-binding domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed abundantly in lung, kidney and adrenal gland, but not in adult brain.

Sequence

MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPR
GTQLSQVEILQRVIDYILDLQVVLAEPAPGPPDGPHLPIQTAELTPELVISNDKRSFCH

Sequence length

119

Interactions

View interactions

	KEGG		Reactome
	TGF-beta signaling pathway Signaling pathways regulating pluripotency of stem cells		NGF-stimulated transcription

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (11)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BURKITT LYMPHOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLONIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hereditary breast ovarian cancer syndrome	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NERVOUS SYSTEM DISEASES	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NERVOUS SYSTEM DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OROPHARYNX CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THYROID DISEASES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (84)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	9525934		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	11161400		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	CTD_human_DG	21552421		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	22151756, 30008847		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Basal Cell	Adenocarcinoma	CTD_human_DG	21552421		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Oxyphilic	Adenocarcinoma	CTD_human_DG	21552421		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Tubular	Adenocarcinoma	CTD_human_DG	21552421		★★★★★ ★☆☆☆☆ Found in Text Mining only
African Burkitt`s lymphoma	African Burkitt`s Lymphoma	CTD_human_DG	23143595, 23143597		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic carcinoma	Anaplastic Carcinoma	CTD_human_DG	12376462		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	11348870, 20185798, 26082558		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	11348870, 20185798, 26082558		★★★★★ ★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	Pubtator	25977194	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	30008847		★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary Tract Neoplasms	Biliary tract neoplasms	Pubtator	24409060	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	30066902	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	32661241	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Leukemia	Burkitt`s Lymphoma	CTD_human_DG	23143595, 23143597		★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	22885699, 22967991, 23143597, 26437030, 26468873, 26712879, 28209658, 28724958, 30567752, 31738823, 34472720, 35794096, 36201743, 37053555, 40572059	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	22967991, 23143595, 24222112		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Burkitt Lymphoma	Burkitt`s Lymphoma	CTD_human_DG	23143595, 23143597		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinogenesis	Carcinogenesis	Pubtator	23342268, 24343358	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	CTD_human_DG	12376462		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Lobular	Lobular carcinoma	Pubtator	32661241	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Cribriform	Carcinoma	CTD_human_DG	21552421		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Granular Cell	Carcinoma	CTD_human_DG	21552421		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Spindle-Cell	Carcinoma	CTD_human_DG	12376462		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	30520117		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	CTD_human_DG	15059925		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Neoplasms	Colonic neoplasm	Pubtator	18513385	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	28767654	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	24222112		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Aneurysm	Coronary aneurysm	Pubtator	24603695	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	24603695, 33271747	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depression in children	Mental Depression	BEFREE	24655651		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	24655651	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	24603695	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	11115836		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	22967991, 24222112		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	25207642, 36232817	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	28767654	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	30520117		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	25644253	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	36443709	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	CTD_human_DG	21552421		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	23593444, 32003423	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	35757721	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	26869608	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	24222112		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG	21552421		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	17199135		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	23342268		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	16394085		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	30008847, 30520117		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	CTD_human_DG	15059925		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	23397264	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	24343358, 39273240	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	29507860		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microvascular Angina	Microvascular angina	Pubtator	25129100	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	CTD_human_DG	16214533		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myositis Ossificans	Myositis	Pubtator	16753021	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	1628620, 16541417, 18069898, 22151756		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	CTD_human_DG	21245421		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neuroblastoma	Neuroblastoma	BEFREE	1628620		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	7777541	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	29507860		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	11161400, 20842131	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	18513385	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	18513385	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	12213214		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	23342268		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	17199135		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	21062988		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	23060149, 23342267, 23342268	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rett Syndrome	Rett Syndrome	LHGDN	16682435		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	40607387	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sicca Syndrome	Sjogren`s Syndrome	BEFREE	18296721		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	16271072		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	31391037	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	20852128		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	16394085		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid Diseases	CTD_human_DG	23397585		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	16394085		★★★★★ ★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	CTD_human_DG	12376462		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin d deficiency	Pubtator	34597852	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

ID3 (inhibitor of DNA binding 3)