GADL1 (glutamate decarboxylase like 1)

Gene

• Entrez ID: 339896
• Gene name: Glutamate decarboxylase like 1
• Gene symbol: GADL1
• Synonyms (NCBI Gene): ADC, CSADC, HuADC, HuCSADC
• Chromosome: 3
• Chromosome location: 3p24.1-p23

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT613531	hsa-miR-4311	HITS-CLIP	23824327
MIRT607370	hsa-miR-8485	HITS-CLIP	23824327
MIRT613531	hsa-miR-4311	HITS-CLIP	23824327
MIRT607370	hsa-miR-8485	HITS-CLIP	23824327
MIRT613531	hsa-miR-4311	HITS-CLIP	23824327
MIRT607370	hsa-miR-8485	HITS-CLIP	23824327
MIRT607370	hsa-miR-8485	HITS-CLIP	24906430
MIRT516108	hsa-miR-146a-3p	PAR-CLIP	20371350
MIRT516106	hsa-miR-301a-5p	PAR-CLIP	20371350
MIRT516105	hsa-miR-301b-5p	PAR-CLIP	20371350
MIRT516104	hsa-miR-3921	PAR-CLIP	20371350
MIRT516103	hsa-miR-4653-5p	PAR-CLIP	20371350
MIRT516101	hsa-miR-4649-3p	PAR-CLIP	20371350
MIRT516102	hsa-miR-7162-3p	PAR-CLIP	20371350
MIRT516100	hsa-miR-619-5p	PAR-CLIP	20371350
MIRT516099	hsa-miR-6506-5p	PAR-CLIP	20371350
MIRT516098	hsa-miR-5008-5p	PAR-CLIP	20371350
MIRT516097	hsa-miR-6089	PAR-CLIP	20371350
MIRT516096	hsa-miR-4320	PAR-CLIP	20371350
MIRT516094	hsa-miR-5089-5p	PAR-CLIP	20371350
MIRT516108	hsa-miR-146a-3p	PAR-CLIP	20371350
MIRT516106	hsa-miR-301a-5p	PAR-CLIP	20371350
MIRT516105	hsa-miR-301b-5p	PAR-CLIP	20371350
MIRT516104	hsa-miR-3921	PAR-CLIP	20371350
MIRT516103	hsa-miR-4653-5p	PAR-CLIP	20371350
MIRT516101	hsa-miR-4649-3p	PAR-CLIP	20371350
MIRT516102	hsa-miR-7162-3p	PAR-CLIP	20371350
MIRT516100	hsa-miR-619-5p	PAR-CLIP	20371350
MIRT516099	hsa-miR-6506-5p	PAR-CLIP	20371350
MIRT516098	hsa-miR-5008-5p	PAR-CLIP	20371350
MIRT516097	hsa-miR-6089	PAR-CLIP	20371350
MIRT516096	hsa-miR-4320	PAR-CLIP	20371350
MIRT516094	hsa-miR-5089-5p	PAR-CLIP	20371350
MIRT516108	hsa-miR-146a-3p	PAR-CLIP	23446348
MIRT516106	hsa-miR-301a-5p	PAR-CLIP	23446348
MIRT516105	hsa-miR-301b-5p	PAR-CLIP	23446348
MIRT516104	hsa-miR-3921	PAR-CLIP	23446348
MIRT516103	hsa-miR-4653-5p	PAR-CLIP	23446348
MIRT516101	hsa-miR-4649-3p	PAR-CLIP	23446348
MIRT516102	hsa-miR-7162-3p	PAR-CLIP	23446348
MIRT516100	hsa-miR-619-5p	PAR-CLIP	23446348
MIRT516099	hsa-miR-6506-5p	PAR-CLIP	23446348
MIRT516098	hsa-miR-5008-5p	PAR-CLIP	23446348
MIRT516097	hsa-miR-6089	PAR-CLIP	23446348
MIRT516096	hsa-miR-4320	PAR-CLIP	23446348
MIRT516094	hsa-miR-5089-5p	PAR-CLIP	23446348
MIRT613531	hsa-miR-4311	HITS-CLIP	27418678
MIRT613531	hsa-miR-4311	HITS-CLIP	27418678
MIRT613531	hsa-miR-4311	HITS-CLIP	27418678
MIRT613531	hsa-miR-4311	HITS-CLIP	27418678
MIRT613531	hsa-miR-4311	HITS-CLIP	27418678
MIRT607370	hsa-miR-8485	HITS-CLIP	27418678
MIRT607370	hsa-miR-8485	HITS-CLIP	27418678
MIRT607370	hsa-miR-8485	HITS-CLIP	27418678
MIRT607370	hsa-miR-8485	HITS-CLIP	27418678
MIRT613531	hsa-miR-4311	HITS-CLIP	23824327
MIRT607370	hsa-miR-8485	HITS-CLIP	23824327
MIRT613531	hsa-miR-4311	HITS-CLIP	23824327
MIRT607370	hsa-miR-8485	HITS-CLIP	23824327
MIRT613531	hsa-miR-4311	HITS-CLIP	23824327
MIRT607370	hsa-miR-8485	HITS-CLIP	23824327
MIRT516108	hsa-miR-146a-3p	PAR-CLIP	20371350
MIRT516106	hsa-miR-301a-5p	PAR-CLIP	20371350
MIRT516105	hsa-miR-301b-5p	PAR-CLIP	20371350
MIRT516104	hsa-miR-3921	PAR-CLIP	20371350
MIRT516103	hsa-miR-4653-5p	PAR-CLIP	20371350
MIRT516101	hsa-miR-4649-3p	PAR-CLIP	20371350
MIRT516102	hsa-miR-7162-3p	PAR-CLIP	20371350
MIRT516100	hsa-miR-619-5p	PAR-CLIP	20371350
MIRT516099	hsa-miR-6506-5p	PAR-CLIP	20371350
MIRT516098	hsa-miR-5008-5p	PAR-CLIP	20371350
MIRT516097	hsa-miR-6089	PAR-CLIP	20371350
MIRT516096	hsa-miR-4320	PAR-CLIP	20371350
MIRT516094	hsa-miR-5089-5p	PAR-CLIP	20371350
MIRT516108	hsa-miR-146a-3p	PAR-CLIP	20371350
MIRT516106	hsa-miR-301a-5p	PAR-CLIP	20371350
MIRT516105	hsa-miR-301b-5p	PAR-CLIP	20371350
MIRT516104	hsa-miR-3921	PAR-CLIP	20371350
MIRT516103	hsa-miR-4653-5p	PAR-CLIP	20371350
MIRT516101	hsa-miR-4649-3p	PAR-CLIP	20371350
MIRT516102	hsa-miR-7162-3p	PAR-CLIP	20371350
MIRT516100	hsa-miR-619-5p	PAR-CLIP	20371350
MIRT516099	hsa-miR-6506-5p	PAR-CLIP	20371350
MIRT516098	hsa-miR-5008-5p	PAR-CLIP	20371350
MIRT516097	hsa-miR-6089	PAR-CLIP	20371350
MIRT516096	hsa-miR-4320	PAR-CLIP	20371350
MIRT516094	hsa-miR-5089-5p	PAR-CLIP	20371350
MIRT516108	hsa-miR-146a-3p	PAR-CLIP	23446348
MIRT516106	hsa-miR-301a-5p	PAR-CLIP	23446348
MIRT516105	hsa-miR-301b-5p	PAR-CLIP	23446348
MIRT516104	hsa-miR-3921	PAR-CLIP	23446348
MIRT516103	hsa-miR-4653-5p	PAR-CLIP	23446348
MIRT516101	hsa-miR-4649-3p	PAR-CLIP	23446348
MIRT516102	hsa-miR-7162-3p	PAR-CLIP	23446348
MIRT516100	hsa-miR-619-5p	PAR-CLIP	23446348
MIRT516099	hsa-miR-6506-5p	PAR-CLIP	23446348
MIRT516098	hsa-miR-5008-5p	PAR-CLIP	23446348
MIRT516097	hsa-miR-6089	PAR-CLIP	23446348
MIRT516096	hsa-miR-4320	PAR-CLIP	23446348
MIRT516094	hsa-miR-5089-5p	PAR-CLIP	23446348
MIRT1010249	hsa-miR-125a-3p	CLIP-seq
MIRT1010250	hsa-miR-1915	CLIP-seq
MIRT1010251	hsa-miR-2113	CLIP-seq
MIRT1010252	hsa-miR-218	CLIP-seq
MIRT1010253	hsa-miR-2964a-5p	CLIP-seq
MIRT1010254	hsa-miR-329	CLIP-seq
MIRT1010255	hsa-miR-362-3p	CLIP-seq
MIRT1010256	hsa-miR-4502	CLIP-seq
MIRT1010257	hsa-miR-451b	CLIP-seq
MIRT1010258	hsa-miR-4726-3p	CLIP-seq
MIRT1010259	hsa-miR-4762-3p	CLIP-seq
MIRT1010260	hsa-miR-4766-3p	CLIP-seq
MIRT1999210	hsa-miR-3065-5p	CLIP-seq
MIRT1999211	hsa-miR-3924	CLIP-seq
MIRT1010257	hsa-miR-451b	CLIP-seq
MIRT1999212	hsa-miR-494	CLIP-seq
MIRT1999213	hsa-miR-505	CLIP-seq
MIRT2388348	hsa-miR-4481	CLIP-seq
MIRT2388349	hsa-miR-4745-5p	CLIP-seq
MIRT2388350	hsa-miR-759	CLIP-seq
MIRT2465340	hsa-miR-3121-5p	CLIP-seq
MIRT2465341	hsa-miR-3128	CLIP-seq
MIRT2465342	hsa-miR-4470	CLIP-seq
MIRT2388348	hsa-miR-4481	CLIP-seq
MIRT2388349	hsa-miR-4745-5p	CLIP-seq
MIRT2388350	hsa-miR-759	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004068	Function	Aspartate 1-decarboxylase activity	IEA
GO:0004782	Function	Sulfinoalanine decarboxylase activity	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005829	Component	Cytosol	TAS
GO:0016829	Function	Lyase activity	IEA
GO:0016830	Function	Carbon-carbon lyase activity	IEA
GO:0016831	Function	Carboxy-lyase activity	IBA
GO:0016831	Function	Carboxy-lyase activity	IEA
GO:0019752	Process	Carboxylic acid metabolic process	IEA
GO:0030170	Function	Pyridoxal phosphate binding	IEA

Other IDs

• MIM: 615601
• HGNC: 27949
• e!Ensembl: ENSG00000144644

Protein

• UniProt ID: Q6ZQY3
• Protein name: Acidic amino acid decarboxylase GADL1 (Aspartate 1-decarboxylase) (ADC) (HuADC) (EC 4.1.1.11) (Cysteine sulfinic acid decarboxylase) (CSADC) (HuCSADC) (EC 4.1.1.29) (Glutamate decarboxylase-like protein 1)
• Protein function: May catalyze the decarboxylation of L-aspartate, 3-sulfino-L-alanine (cysteine sulfinic acid), and L-cysteate to beta-alanine, hypotaurine and taurine, respectively. Does not exhibit any decarboxylation activity toward glutamate. {ECO:0000269|Pu
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00282	Pyridoxal_deC	77 → 445	Pyridoxal-dependent decarboxylase conserved domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed very weakly in neurons and not detected in astrocytes, brain or liver. {ECO:0000269|PubMed:26327310}.
• Sequence:

  MSSDSDRQCPVDGDIDQQEMIPSKKNAVLVDGVVLNGPTTDAKAGEKFVEEACRLIMEEV
  VLKATDVNEKVCEWRPPEQLKQLLDLEMRDSGEPPHKLLELCRDVIHYSVKTNHPRFFNQ
  LYAGLDYYSLVARFMTEALNPSVYTYEVSPVFLLVEEAVLKKMIEFIGWKEGDGIFNPGG
  SVSNMYAMNLARYKYCPDIKEKGLSGSPRLILFTSAECHYSMKKAASFLGIGTENVCFVE
  TDGRGKMIPEELEKQVWQARKEGAAPFLVCATSGTTVLGAFDPLDEIADICERHSLWLHV
  DASWGGSALMSRKHRKLLHGIHRADSVAWNPHKMLMAGIQCCALLVKDKSDLLKKCYSAK
  ASYLFQQDKFYDVSYDTGDKSIQCSRRPDAFKFWMTWKALGTLGLEERVNRALALSRYLV
  DEIKKREGFKLLMEPEYANICFWYIPPSLREMEEGPEFWAKLNLVAPAIKERMMKKGSLM
  LGYQPHRGKVNFFRQVVISPQVSREDMDFLLDEIDLLGKDM

• Sequence length: 521

Pathways

KEGG:

beta-Alanine metabolism
Taurine and hypotaurine metabolism
Pantothenate and CoA biosynthesis
Metabolic pathways

Reactome:

Degradation of cysteine and homocysteine
Aspartate and asparagine metabolism

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANGIOEDEMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR I DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EATING DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute pancreatitis	Pancreatitis	BEFREE	28068586		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	18957720, 20686609, 22031317, 22865300, 22963397, 23266446, 23723294, 25194563, 26211588, 26252352, 28263037, 29027397, 29074606, 29110846, 29871672, 30266585, 30339668, 31308421, 7512370		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	22080568, 23677397, 29045509, 29301782		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	28152252		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of rectum	Adenocarcinoma Of Rectum	BEFREE	31642964		★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	30846400		★☆☆☆☆ Found in Text Mining only
Amnesia, Transient Global	Amnesia	BEFREE	28112030		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	30128146		★☆☆☆☆ Found in Text Mining only
Anal carcinoma	Anal Cancer	BEFREE	30339668		★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	30846400		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	24557705, 28006727, 28450436		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	28216140		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	28214779		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	30475249, 30955071		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	24369049, 30923325, 31767892	Associate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	28214779		★☆☆☆☆ Found in Text Mining only
Bipolar I disorder	Bipolar Disorder	BEFREE	24369049, 31767892		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar I disorder	Bipolar Disorder	PSYGENET_DG	24369049		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bladder Neoplasm	Bladder Neoplasm	BEFREE	25316820, 29740903		★☆☆☆☆ Found in Text Mining only
Brain Abscess	Brain Abscess	BEFREE	29719596		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	27734275, 29301780		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	29045509, 29134565, 29717790, 30867160, 30937834, 31843763		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	30843650		★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	25316820, 29740903		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	29301782		★☆☆☆☆ Found in Text Mining only
Carcinoma, Neuroendocrine	Carcinoma	BEFREE	23060301		★☆☆☆☆ Found in Text Mining only
Carcinoma, Spindle-Cell	Carcinoma	BEFREE	23266446		★☆☆☆☆ Found in Text Mining only
Carney Complex	Carney Complex	BEFREE	31390342		★☆☆☆☆ Found in Text Mining only
Central Nervous System Neoplasms	Central Nervous System Neoplasms	BEFREE	30738940		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	30284459, 30571431		★☆☆☆☆ Found in Text Mining only
CHARGE Syndrome	CHARGE Syndrome	BEFREE	31154243		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	31593106		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	28295820, 28959212		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	30630659		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	29392365, 29732007		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	28928666		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	29045509		★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	7512370		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30087067		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	29214167, 29779158		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	30814576		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	30814576		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	27886608		★☆☆☆☆ Found in Text Mining only
Diffuse Astrocytoma	Astrocytoma	BEFREE	27858213		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	29803384, 31206949, 31511958		★☆☆☆☆ Found in Text Mining only
Ependymoma	Ependymoma	BEFREE	31390342		★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	31250178		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	29764854		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	24949678, 27932505, 28279985, 29255149, 29274693, 29301781, 29719596, 29721688, 29733920, 30002055, 31229576, 31694820		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	24949678, 27932505, 28279985, 29255149, 29274693, 29301781, 29719596, 29721688, 29733920, 30002055, 31229576		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	28209583, 30190259		★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	BEFREE	31154243		★☆☆☆☆ Found in Text Mining only
Hemolytic-Uremic Syndrome	Hemolytic Uremic Syndrome	BEFREE	28500363		★☆☆☆☆ Found in Text Mining only
Hepatocellular Adenoma	Hepatocellular adenoma	BEFREE	31134313		★☆☆☆☆ Found in Text Mining only
Idiopathic Hypogonadotropic Hypogonadism	Hypogonadotropic hypogonadism	Pubtator	33208564	Associate	★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	31767892		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	31767892	Associate	★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	29110943, 31134313		★☆☆☆☆ Found in Text Mining only
Islet Cell Tumor	Islet Cell Tumor	BEFREE	29352378		★☆☆☆☆ Found in Text Mining only
Language Development Disorders	Language Development Disorders	BEFREE	29934818		★☆☆☆☆ Found in Text Mining only
LATERAL MENINGOCELE SYNDROME	Lateral Meningocele Syndrome	BEFREE	30637854		★☆☆☆☆ Found in Text Mining only
leiomyosarcoma	Leiomyosarcoma	BEFREE	31250178		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	29959143		★☆☆☆☆ Found in Text Mining only
LEUKOENCEPHALOPATHY, BRAIN CALCIFICATIONS, AND CYSTS	LEUKOENCEPHALOPATHY, BRAIN CALCIFICATIONS, AND CYSTS	BEFREE	22031317		★☆☆☆☆ Found in Text Mining only
LIMB-MAMMARY SYNDROME	Limb-Mammary Syndrome	BEFREE	30637854		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	22031317, 29110943, 29392365, 30027408, 30972544, 31134313, 31142363, 31169907, 31507025		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	29392365, 29732007		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	CTD_human_DG	19233941		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	BEFREE	22031317		★☆☆☆☆ Found in Text Mining only
Macular Edema, Cystoid	Cystoid macular edema	BEFREE	27886608		★☆☆☆☆ Found in Text Mining only
Macular retinal edema	Macular edema	BEFREE	27886608		★☆☆☆☆ Found in Text Mining only
Malignant Bone Neoplasm	Malignant Bone Neoplasm	BEFREE	31122153		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	29301781, 31753834		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	29045509, 29134565, 29717790, 30867160, 30937834, 31843763		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	29803384, 31206949, 31511958		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	CTD_human_DG	19233941		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	29301782		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	31182754, 31700121		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	27287481, 28224172, 28238033, 29045509, 30024051, 30066169, 30368893, 30655050, 30955071		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	25316820, 29740903		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	26823024, 27900458, 28188066, 28497665, 28878234, 28978081, 28987685, 29362152, 29731160, 30475249, 30553852, 30919763, 31136112, 31218387, 31422219, 31484577, 31507025		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	21245091, 24651527, 29550398		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	28017250, 29709881, 29748203, 30469018, 30819773, 31476455		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	29959059		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	29230672, 30557373		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	30630832		★☆☆☆☆ Found in Text Mining only
Neck Neoplasms	Neck Neoplasms	BEFREE	28542474		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	17700060, 23221948, 23677397, 24557705, 26211588, 26252352, 27620864, 27631107, 27651141, 27859961, 27932505, 28070598, 28126746, 28139036, 28279985, 28408629, 28409357, 28450436, 28542474, 28623761, 28808917, 28835111, 28912282, 29023986, 29027397, 29045509, 29063250, 29134565, 29270644, 29301780, 29322269, 29352378, 29515794, 29519794, 29630391, 29706186, 29721688, 29742918, 29748203, 29769042, 29803384, 29922931, 30052649, 30219612, 30230114, 30250016, 30315419, 30468734, 30518386, 30527182, 30599864, 30738940, 30756272, 30769222, 30810823, 30846790, 31022951, 31134313, 31136748, 31206949, 31250178, 31317002, 31324948, 31335678, 31352016, 31431368, 31439233, 31484577, 31511958, 31694820, 31730015, 31806599		★☆☆☆☆ Found in Text Mining only
Neoplasms, Intracranial	Intracranial Neoplasm	BEFREE	30738940		★☆☆☆☆ Found in Text Mining only
Neurilemmoma	Neurilemmoma	BEFREE	28821978		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	30923325		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	30923325	Associate	★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	31134313		★☆☆☆☆ Found in Text Mining only
neurofibroma	Neurofibroma	BEFREE	28821978		★☆☆☆☆ Found in Text Mining only
Neurofibromatoses	Neurofibromatosis	BEFREE	28821978		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	22865300, 23266446, 25977220, 26252352, 29074606, 30266585, 30870998, 30919763, 31555517, 7512370		★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	31323316		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	27974301	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	31182754, 31700121		★☆☆☆☆ Found in Text Mining only
Pilocytic Astrocytoma	Astrocytoma	BEFREE	30642288		★☆☆☆☆ Found in Text Mining only
Pleural effusion disorder	Pleural effusion	BEFREE	7512370		★☆☆☆☆ Found in Text Mining only
Primary central nervous system lymphoma	Central Nervous System Lymphoma	BEFREE	27932505		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	27287481, 28224172, 28238033, 29045509, 30024051, 30066169, 30368893, 30655050, 30955071		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	30368893		★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	29450716, 29719621		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	28786011		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	26799356, 29301782, 30919763		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	19674850, 22031317, 23060301, 23723294, 25194563, 26211588, 28978081, 29074606, 29871672, 30266585, 31157548, 7512370		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	29297204, 29731125		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	29045509		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of oropharynx	Oropharyngeal carcinoma	BEFREE	30213805		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	28912282, 29706186, 30188926, 30213809		★☆☆☆☆ Found in Text Mining only
Thyroid Nodule	Thyroid Nodule	BEFREE	29899853		★☆☆☆☆ Found in Text Mining only
Trigeminal Neuralgia	Trigeminal neuralgia	BEFREE	30402704, 31696300		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	28928666		★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	31250178		★☆☆☆☆ Found in Text Mining only