C2orf74 (chromosome 2 open reading frame 74)

Gene

• Entrez ID: 339804
• Gene name: Chromosome 2 open reading frame 74
• Gene symbol: C2orf74
• Synonyms (NCBI Gene): -
• Chromosome: 2
• Chromosome location: 2p15

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT003878	hsa-miR-15a-5p	Microarray	18362358
MIRT004372	hsa-miR-16-5p	Microarray	18362358
MIRT846398	hsa-miR-24	CLIP-seq
MIRT846399	hsa-miR-3130-3p	CLIP-seq
MIRT846400	hsa-miR-3545-3p	CLIP-seq
MIRT846401	hsa-miR-3935	CLIP-seq
MIRT846402	hsa-miR-4284	CLIP-seq
MIRT846403	hsa-miR-4330	CLIP-seq
MIRT846404	hsa-miR-4477b	CLIP-seq
MIRT846405	hsa-miR-450b-5p	CLIP-seq
MIRT846406	hsa-miR-4635	CLIP-seq
MIRT846407	hsa-miR-4666-3p	CLIP-seq
MIRT846408	hsa-miR-4680-5p	CLIP-seq
MIRT846409	hsa-miR-4717-3p	CLIP-seq
MIRT846410	hsa-miR-4773	CLIP-seq
MIRT846411	hsa-miR-4793-3p	CLIP-seq
MIRT846412	hsa-miR-483-3p	CLIP-seq
MIRT846413	hsa-miR-507	CLIP-seq
MIRT846414	hsa-miR-526b	CLIP-seq
MIRT846415	hsa-miR-544	CLIP-seq
MIRT846416	hsa-miR-548ag	CLIP-seq
MIRT846417	hsa-miR-548ai	CLIP-seq
MIRT846418	hsa-miR-548m	CLIP-seq
MIRT846419	hsa-miR-557	CLIP-seq
MIRT846420	hsa-miR-578	CLIP-seq
MIRT846421	hsa-miR-600	CLIP-seq
MIRT846422	hsa-miR-889	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0016020	Component	Membrane	IEA

Other IDs

• MIM: HGNC
• HGNC: N/A
• e!Ensembl: HGNC

Protein

• UniProt ID: A8MZ97
• Protein name: Uncharacterized protein C2orf74
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15484	DUF4642	39 → 194	Domain of unknown function (DUF4642)	Family

• Sequence:

  MSLLAKPMSFETTAITFFIILLICLICILLLLVVFLYKCFQGRKGKETKKVPCTDANGGV
  DCAAAKVVTSNPEDHERILMQVMNLNVPMRPGILVQRQSKEVLATPLENRRDMEAEEENQ
  INEKQEPENAGETGQEEDDGLQKIHTSVTRTPSVVESQKRPLKGVTFSREVIVVDLGNEY
  PTPRSYTREHKERK

• Sequence length: 194

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CROHN'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	28493913		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	26859134	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	27058892		★☆☆☆☆ Found in Text Mining only
Waardenburg Syndrome	Waardenburg syndrome	Pubtator	33571247	Associate	★☆☆☆☆ Found in Text Mining only
Waardenburg syndrome type 2A	Waardenburg syndrome	Pubtator	33571247	Associate	★☆☆☆☆ Found in Text Mining only