ID2 (inhibitor of DNA binding 2)

Gene

• Entrez ID: 3398
• Gene name: Inhibitor of DNA binding 2
• Gene symbol: ID2
• Synonyms (NCBI Gene): GIG8, ID2A, ID2H, bHLHb26
• Chromosome: 2
• Chromosome location: 2p25.1
• Summary: The protein encoded by this gene belongs to the inhibitor of DNA binding family, members of which are transcriptional regulators that contain a helix-loop-helix (HLH) domain but not a basic domain. Members of the inhibitor of DNA binding family inhibit th

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT007060	hsa-miR-9-5p	Immunoblot, Immunohistochemistry, Luciferase reporter assay, Northern blot, qRT-PCR	22848373
MIRT007062	hsa-miR-103a-3p	Immunoblot, Immunohistochemistry, Luciferase reporter assay, Northern blot, qRT-PCR	22848373
MIRT023177	hsa-miR-124-3p	Microarray	18668037
MIRT024314	hsa-miR-215-5p	Microarray	19074876
MIRT026921	hsa-miR-192-5p	Microarray	19074876
MIRT043878	hsa-miR-378a-3p	CLASH	23622248
MIRT354192	hsa-miR-548n	PAR-CLIP	21572407
MIRT354196	hsa-miR-548az-5p	PAR-CLIP	21572407
MIRT354193	hsa-miR-548t-5p	PAR-CLIP	21572407
MIRT255131	hsa-miR-1264	PAR-CLIP	21572407
MIRT207544	hsa-miR-4418	PAR-CLIP	21572407
MIRT207539	hsa-miR-509-3-5p	PAR-CLIP	21572407
MIRT207538	hsa-miR-509-5p	PAR-CLIP	21572407
MIRT207546	hsa-miR-4761-3p	PAR-CLIP	21572407
MIRT207541	hsa-miR-3158-5p	PAR-CLIP	21572407
MIRT207548	hsa-miR-5681a	PAR-CLIP	21572407
MIRT523045	hsa-miR-298	PAR-CLIP	21572407
MIRT354192	hsa-miR-548n	PAR-CLIP	23446348
MIRT354196	hsa-miR-548az-5p	PAR-CLIP	23446348
MIRT354193	hsa-miR-548t-5p	PAR-CLIP	23446348
MIRT523046	hsa-miR-5692a	PAR-CLIP	23446348
MIRT255131	hsa-miR-1264	PAR-CLIP	23446348
MIRT207544	hsa-miR-4418	PAR-CLIP	23446348
MIRT207539	hsa-miR-509-3-5p	PAR-CLIP	23446348
MIRT207538	hsa-miR-509-5p	PAR-CLIP	23446348
MIRT207546	hsa-miR-4761-3p	PAR-CLIP	23446348
MIRT207541	hsa-miR-3158-5p	PAR-CLIP	23446348
MIRT207548	hsa-miR-5681a	PAR-CLIP	23446348
MIRT523045	hsa-miR-298	PAR-CLIP	23446348
MIRT523044	hsa-miR-335-3p	PAR-CLIP	23446348
MIRT496532	hsa-miR-6768-5p	PAR-CLIP	22291592
MIRT496531	hsa-miR-1179	PAR-CLIP	22291592
MIRT496530	hsa-miR-4310	PAR-CLIP	22291592
MIRT496529	hsa-miR-7157-5p	PAR-CLIP	22291592
MIRT496528	hsa-miR-936	PAR-CLIP	22291592
MIRT496527	hsa-miR-199a-3p	PAR-CLIP	22291592
MIRT496526	hsa-miR-199b-3p	PAR-CLIP	22291592
MIRT496525	hsa-miR-3129-5p	PAR-CLIP	22291592
MIRT496524	hsa-miR-581	PAR-CLIP	22291592
MIRT496523	hsa-miR-4672	PAR-CLIP	22291592
MIRT496522	hsa-miR-4789-5p	PAR-CLIP	22291592
MIRT496521	hsa-miR-222-5p	PAR-CLIP	22291592
MIRT736294	hsa-miR-210-3p	RNA-seq, Flow cytometry	32099460
MIRT354192	hsa-miR-548n	PAR-CLIP	21572407
MIRT354196	hsa-miR-548az-5p	PAR-CLIP	21572407
MIRT354193	hsa-miR-548t-5p	PAR-CLIP	21572407
MIRT255131	hsa-miR-1264	PAR-CLIP	21572407
MIRT207544	hsa-miR-4418	PAR-CLIP	21572407
MIRT207539	hsa-miR-509-3-5p	PAR-CLIP	21572407
MIRT207538	hsa-miR-509-5p	PAR-CLIP	21572407
MIRT207546	hsa-miR-4761-3p	PAR-CLIP	21572407
MIRT207541	hsa-miR-3158-5p	PAR-CLIP	21572407
MIRT207548	hsa-miR-5681a	PAR-CLIP	21572407
MIRT523045	hsa-miR-298	PAR-CLIP	21572407
MIRT354192	hsa-miR-548n	PAR-CLIP	23446348
MIRT354196	hsa-miR-548az-5p	PAR-CLIP	23446348
MIRT354193	hsa-miR-548t-5p	PAR-CLIP	23446348
MIRT523046	hsa-miR-5692a	PAR-CLIP	23446348
MIRT255131	hsa-miR-1264	PAR-CLIP	23446348
MIRT207544	hsa-miR-4418	PAR-CLIP	23446348
MIRT207539	hsa-miR-509-3-5p	PAR-CLIP	23446348
MIRT207538	hsa-miR-509-5p	PAR-CLIP	23446348
MIRT207546	hsa-miR-4761-3p	PAR-CLIP	23446348
MIRT207541	hsa-miR-3158-5p	PAR-CLIP	23446348
MIRT207548	hsa-miR-5681a	PAR-CLIP	23446348
MIRT523045	hsa-miR-298	PAR-CLIP	23446348
MIRT523044	hsa-miR-335-3p	PAR-CLIP	23446348
MIRT496532	hsa-miR-6768-5p	PAR-CLIP	22291592
MIRT496531	hsa-miR-1179	PAR-CLIP	22291592
MIRT496530	hsa-miR-4310	PAR-CLIP	22291592
MIRT496529	hsa-miR-7157-5p	PAR-CLIP	22291592
MIRT496528	hsa-miR-936	PAR-CLIP	22291592
MIRT496527	hsa-miR-199a-3p	PAR-CLIP	22291592
MIRT496526	hsa-miR-199b-3p	PAR-CLIP	22291592
MIRT496525	hsa-miR-3129-5p	PAR-CLIP	22291592
MIRT496524	hsa-miR-581	PAR-CLIP	22291592
MIRT496523	hsa-miR-4672	PAR-CLIP	22291592
MIRT496522	hsa-miR-4789-5p	PAR-CLIP	22291592
MIRT496521	hsa-miR-222-5p	PAR-CLIP	22291592
MIRT1058967	hsa-miR-1237	CLIP-seq
MIRT1058968	hsa-miR-1243	CLIP-seq
MIRT1058969	hsa-miR-1248	CLIP-seq
MIRT1058970	hsa-miR-200b	CLIP-seq
MIRT1058971	hsa-miR-200c	CLIP-seq
MIRT1058972	hsa-miR-203	CLIP-seq
MIRT1058973	hsa-miR-2355-3p	CLIP-seq
MIRT1058974	hsa-miR-3065-3p	CLIP-seq
MIRT1058975	hsa-miR-3121-3p	CLIP-seq
MIRT1058976	hsa-miR-3136-5p	CLIP-seq
MIRT1058977	hsa-miR-3545-3p	CLIP-seq
MIRT1058978	hsa-miR-3611	CLIP-seq
MIRT1058979	hsa-miR-3618	CLIP-seq
MIRT1058980	hsa-miR-3620	CLIP-seq
MIRT1058981	hsa-miR-3654	CLIP-seq
MIRT1058982	hsa-miR-3909	CLIP-seq
MIRT1058983	hsa-miR-3940-5p	CLIP-seq
MIRT1058984	hsa-miR-429	CLIP-seq
MIRT1058985	hsa-miR-4291	CLIP-seq
MIRT1058986	hsa-miR-4292	CLIP-seq
MIRT1058987	hsa-miR-4427	CLIP-seq
MIRT1058988	hsa-miR-4439	CLIP-seq
MIRT1058989	hsa-miR-4490	CLIP-seq
MIRT1058990	hsa-miR-4507	CLIP-seq
MIRT1058991	hsa-miR-4513	CLIP-seq
MIRT1058992	hsa-miR-4646-5p	CLIP-seq
MIRT1058993	hsa-miR-4727-5p	CLIP-seq
MIRT1058994	hsa-miR-4747-5p	CLIP-seq
MIRT1058995	hsa-miR-4760-5p	CLIP-seq
MIRT1058996	hsa-miR-4769-3p	CLIP-seq
MIRT1058997	hsa-miR-4774-5p	CLIP-seq
MIRT1058998	hsa-miR-502-5p	CLIP-seq
MIRT1058999	hsa-miR-513a-3p	CLIP-seq
MIRT1059000	hsa-miR-522	CLIP-seq
MIRT1059001	hsa-miR-541	CLIP-seq
MIRT1059002	hsa-miR-548an	CLIP-seq
MIRT1059003	hsa-miR-563	CLIP-seq
MIRT1059004	hsa-miR-643	CLIP-seq
MIRT1059005	hsa-miR-654-5p	CLIP-seq
MIRT1059006	hsa-miR-676	CLIP-seq
MIRT1059007	hsa-miR-935	CLIP-seq
MIRT1058967	hsa-miR-1237	CLIP-seq
MIRT1058968	hsa-miR-1243	CLIP-seq
MIRT1058969	hsa-miR-1248	CLIP-seq
MIRT2245865	hsa-miR-128	CLIP-seq
MIRT2245866	hsa-miR-134	CLIP-seq
MIRT2245867	hsa-miR-142-5p	CLIP-seq
MIRT2245868	hsa-miR-186	CLIP-seq
MIRT1058970	hsa-miR-200b	CLIP-seq
MIRT1058971	hsa-miR-200c	CLIP-seq
MIRT2245869	hsa-miR-27a	CLIP-seq
MIRT2245870	hsa-miR-27b	CLIP-seq
MIRT1058974	hsa-miR-3065-3p	CLIP-seq
MIRT2245871	hsa-miR-3118	CLIP-seq
MIRT1058975	hsa-miR-3121-3p	CLIP-seq
MIRT2245872	hsa-miR-3133	CLIP-seq
MIRT1058976	hsa-miR-3136-5p	CLIP-seq
MIRT2245873	hsa-miR-330-3p	CLIP-seq
MIRT2245874	hsa-miR-340	CLIP-seq
MIRT1058977	hsa-miR-3545-3p	CLIP-seq
MIRT1058979	hsa-miR-3618	CLIP-seq
MIRT1058980	hsa-miR-3620	CLIP-seq
MIRT1058981	hsa-miR-3654	CLIP-seq
MIRT2245875	hsa-miR-3691-3p	CLIP-seq
MIRT2245876	hsa-miR-374a	CLIP-seq
MIRT2245877	hsa-miR-374b	CLIP-seq
MIRT1058982	hsa-miR-3909	CLIP-seq
MIRT2245878	hsa-miR-3925-5p	CLIP-seq
MIRT2245879	hsa-miR-410	CLIP-seq
MIRT1058984	hsa-miR-429	CLIP-seq
MIRT1058985	hsa-miR-4291	CLIP-seq
MIRT1058986	hsa-miR-4292	CLIP-seq
MIRT2245880	hsa-miR-4422	CLIP-seq
MIRT1058987	hsa-miR-4427	CLIP-seq
MIRT1058988	hsa-miR-4439	CLIP-seq
MIRT1058989	hsa-miR-4490	CLIP-seq
MIRT1058991	hsa-miR-4513	CLIP-seq
MIRT2245881	hsa-miR-455-3p	CLIP-seq
MIRT1058992	hsa-miR-4646-5p	CLIP-seq
MIRT2245882	hsa-miR-4690-5p	CLIP-seq
MIRT2245883	hsa-miR-4705	CLIP-seq
MIRT2245884	hsa-miR-4729	CLIP-seq
MIRT2245885	hsa-miR-4742-5p	CLIP-seq
MIRT1058994	hsa-miR-4747-5p	CLIP-seq
MIRT2245886	hsa-miR-4766-5p	CLIP-seq
MIRT1058997	hsa-miR-4774-5p	CLIP-seq
MIRT2245887	hsa-miR-499-3p	CLIP-seq
MIRT2245888	hsa-miR-499a-3p	CLIP-seq
MIRT1058998	hsa-miR-502-5p	CLIP-seq
MIRT1058999	hsa-miR-513a-3p	CLIP-seq
MIRT1059001	hsa-miR-541	CLIP-seq
MIRT2245889	hsa-miR-548t	CLIP-seq
MIRT2245890	hsa-miR-548u	CLIP-seq
MIRT2245891	hsa-miR-579	CLIP-seq
MIRT2245892	hsa-miR-592	CLIP-seq
MIRT2245893	hsa-miR-597	CLIP-seq
MIRT2245894	hsa-miR-599	CLIP-seq
MIRT1059004	hsa-miR-643	CLIP-seq
MIRT1059005	hsa-miR-654-5p	CLIP-seq
MIRT1058967	hsa-miR-1237	CLIP-seq
MIRT1058968	hsa-miR-1243	CLIP-seq
MIRT1058969	hsa-miR-1248	CLIP-seq
MIRT1058970	hsa-miR-200b	CLIP-seq
MIRT1058971	hsa-miR-200c	CLIP-seq
MIRT1058981	hsa-miR-3654	CLIP-seq
MIRT1058984	hsa-miR-429	CLIP-seq
MIRT1058989	hsa-miR-4490	CLIP-seq
MIRT1058995	hsa-miR-4760-5p	CLIP-seq
MIRT1058997	hsa-miR-4774-5p	CLIP-seq
MIRT1058998	hsa-miR-502-5p	CLIP-seq
MIRT1059001	hsa-miR-541	CLIP-seq
MIRT1059002	hsa-miR-548an	CLIP-seq
MIRT1059005	hsa-miR-654-5p	CLIP-seq
MIRT1058967	hsa-miR-1237	CLIP-seq
MIRT1058968	hsa-miR-1243	CLIP-seq
MIRT1058969	hsa-miR-1248	CLIP-seq
MIRT2682553	hsa-miR-1276	CLIP-seq
MIRT2682554	hsa-miR-1284	CLIP-seq
MIRT2245867	hsa-miR-142-5p	CLIP-seq
MIRT2245868	hsa-miR-186	CLIP-seq
MIRT1058970	hsa-miR-200b	CLIP-seq
MIRT1058971	hsa-miR-200c	CLIP-seq
MIRT2682555	hsa-miR-300	CLIP-seq
MIRT1058975	hsa-miR-3121-3p	CLIP-seq
MIRT2245872	hsa-miR-3133	CLIP-seq
MIRT2245874	hsa-miR-340	CLIP-seq
MIRT1058981	hsa-miR-3654	CLIP-seq
MIRT2682556	hsa-miR-3671	CLIP-seq
MIRT2682557	hsa-miR-381	CLIP-seq
MIRT2245879	hsa-miR-410	CLIP-seq
MIRT2682558	hsa-miR-4252	CLIP-seq
MIRT1058984	hsa-miR-429	CLIP-seq
MIRT2682559	hsa-miR-4311	CLIP-seq
MIRT2682560	hsa-miR-4457	CLIP-seq
MIRT1058989	hsa-miR-4490	CLIP-seq
MIRT2682561	hsa-miR-4666-3p	CLIP-seq
MIRT2682562	hsa-miR-4735-5p	CLIP-seq
MIRT1058995	hsa-miR-4760-5p	CLIP-seq
MIRT1058997	hsa-miR-4774-5p	CLIP-seq
MIRT1058998	hsa-miR-502-5p	CLIP-seq
MIRT2682563	hsa-miR-513b	CLIP-seq
MIRT1059001	hsa-miR-541	CLIP-seq
MIRT1059002	hsa-miR-548an	CLIP-seq
MIRT2682564	hsa-miR-583	CLIP-seq
MIRT2682565	hsa-miR-618	CLIP-seq
MIRT2682566	hsa-miR-624	CLIP-seq
MIRT1059005	hsa-miR-654-5p	CLIP-seq
MIRT2682567	hsa-miR-888	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
FLI1	Activation	12447693
HOXA10	Activation	20565746
HOXA9	Activation	20565746
MYC	Unknown	12545167
MYCN	Unknown	12670915
POU2AF1	Unknown	24801987
POU2F2	Unknown	24801987
POU5F1	Repression	17068183
TP53	Unknown	16557594
TP63	Repression	21478550
ZBTB16	Unknown	19723763

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	ISS
GO:0000791	Component	Euchromatin	IEA
GO:0000791	Component	Euchromatin	ISS
GO:0001656	Process	Metanephros development	IEA
GO:0001779	Process	Natural killer cell differentiation	IEA
GO:0001966	Process	Thigmotaxis	IEA
GO:0002521	Process	Leukocyte differentiation	IEA
GO:0003149	Process	Membranous septum morphogenesis	IEA
GO:0003166	Process	Bundle of His development	IEA
GO:0003166	Process	Bundle of His development	ISS
GO:0003714	Function	Transcription corepressor activity	IBA
GO:0005515	Function	Protein binding	IPI	10915743, 14752053, 16311606, 16549780, 19321746, 20861012, 22453338, 25609649, 28514442, 32296183, 32814053, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IC	14627819
GO:0005634	Component	Nucleus	IDA	16311606
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	16311606
GO:0005737	Component	Cytoplasm	IDA	20861012
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA	16311606
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IMP	16311606
GO:0007507	Process	Heart development	IEA
GO:0007507	Process	Heart development	ISS
GO:0007623	Process	Circadian rhythm	IEA
GO:0007623	Process	Circadian rhythm	ISS
GO:0008344	Process	Adult locomotory behavior	IEA
GO:0009649	Process	Entrainment of circadian clock	IEA
GO:0010468	Process	Regulation of gene expression	IEA
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010628	Process	Positive regulation of gene expression	ISS
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0010629	Process	Negative regulation of gene expression	ISS
GO:0014003	Process	Oligodendrocyte development	IEA
GO:0019216	Process	Regulation of lipid metabolic process	IEA
GO:0019216	Process	Regulation of lipid metabolic process	ISS
GO:0021772	Process	Olfactory bulb development	IEA
GO:0021772	Process	Olfactory bulb development	ISS
GO:0030182	Process	Neuron differentiation	IBA
GO:0030183	Process	B cell differentiation	IEA
GO:0030218	Process	Erythrocyte differentiation	IEA
GO:0032922	Process	Circadian regulation of gene expression	IEA
GO:0032922	Process	Circadian regulation of gene expression	ISS
GO:0032991	Component	Protein-containing complex	IEA
GO:0032991	Component	Protein-containing complex	ISS
GO:0033598	Process	Mammary gland epithelial cell proliferation	IEA
GO:0033598	Process	Mammary gland epithelial cell proliferation	ISS
GO:0042752	Process	Regulation of circadian rhythm	IEA
GO:0042752	Process	Regulation of circadian rhythm	ISS
GO:0043153	Process	Entrainment of circadian clock by photoperiod	IEA
GO:0043153	Process	Entrainment of circadian clock by photoperiod	ISS
GO:0043353	Process	Enucleate erythrocyte differentiation	IEA
GO:0043353	Process	Enucleate erythrocyte differentiation	ISS
GO:0043433	Process	Negative regulation of DNA-binding transcription factor activity	IDA	14627819
GO:0044325	Function	Transmembrane transporter binding	IPI	16311606
GO:0045475	Process	Locomotor rhythm	IEA
GO:0045475	Process	Locomotor rhythm	ISS
GO:0045578	Process	Negative regulation of B cell differentiation	IEA
GO:0045578	Process	Negative regulation of B cell differentiation	ISS
GO:0045600	Process	Positive regulation of fat cell differentiation	IEA
GO:0045600	Process	Positive regulation of fat cell differentiation	ISS
GO:0045648	Process	Positive regulation of erythrocyte differentiation	IEA
GO:0045651	Process	Positive regulation of macrophage differentiation	IEA
GO:0045651	Process	Positive regulation of macrophage differentiation	ISS
GO:0045664	Process	Regulation of neuron differentiation	IEA
GO:0045664	Process	Regulation of neuron differentiation	ISS
GO:0045668	Process	Negative regulation of osteoblast differentiation	IEA
GO:0045777	Process	Positive regulation of blood pressure	IEA
GO:0045777	Process	Positive regulation of blood pressure	ISS
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	14627819
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	ISS
GO:0046983	Function	Protein dimerization activity	IEA
GO:0048468	Process	Cell development	IEA
GO:0048469	Process	Cell maturation	IEA
GO:0048511	Process	Rhythmic process	IEA
GO:0048541	Process	Peyer's patch development	IEA
GO:0048557	Process	Embryonic digestive tract morphogenesis	IEA
GO:0048557	Process	Embryonic digestive tract morphogenesis	ISS
GO:0048661	Process	Positive regulation of smooth muscle cell proliferation	IEA
GO:0048661	Process	Positive regulation of smooth muscle cell proliferation	ISS
GO:0048663	Process	Neuron fate commitment	IEA
GO:0048663	Process	Neuron fate commitment	ISS
GO:0048667	Process	Cell morphogenesis involved in neuron differentiation	IEA
GO:0048708	Process	Astrocyte differentiation	IEA
GO:0048709	Process	Oligodendrocyte differentiation	IEA
GO:0048711	Process	Positive regulation of astrocyte differentiation	IEA
GO:0048711	Process	Positive regulation of astrocyte differentiation	ISS
GO:0048715	Process	Negative regulation of oligodendrocyte differentiation	IEA
GO:0050872	Process	White fat cell differentiation	IEA
GO:0051148	Process	Negative regulation of muscle cell differentiation	IEA
GO:0051148	Process	Negative regulation of muscle cell differentiation	ISS
GO:0060612	Process	Adipose tissue development	IEA
GO:0060749	Process	Mammary gland alveolus development	IEA
GO:0060749	Process	Mammary gland alveolus development	ISS
GO:0061030	Process	Epithelial cell differentiation involved in mammary gland alveolus development	IEA
GO:0061030	Process	Epithelial cell differentiation involved in mammary gland alveolus development	ISS
GO:0061031	Process	Endodermal digestive tract morphogenesis	IEA
GO:0061031	Process	Endodermal digestive tract morphogenesis	ISS
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IEA
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	ISS
GO:0071285	Process	Cellular response to lithium ion	IEA
GO:0071542	Process	Dopaminergic neuron differentiation	IEA
GO:0090398	Process	Cellular senescence	IEA
GO:0090398	Process	Cellular senescence	ISS
GO:0140416	Function	Transcription regulator inhibitor activity	IEA
GO:0140416	Function	Transcription regulator inhibitor activity	ISS
GO:0140416	Function	Transcription regulator inhibitor activity	TAS	25248477
GO:1904339	Process	Negative regulation of dopaminergic neuron differentiation	IEA
GO:2000045	Process	Regulation of G1/S transition of mitotic cell cycle	IMP	16311606
GO:2000177	Process	Regulation of neural precursor cell proliferation	IEA
GO:2000177	Process	Regulation of neural precursor cell proliferation	ISS

Other IDs

• MIM: 600386
• HGNC: 5361
• e!Ensembl: ENSG00000115738

Protein

• UniProt ID: Q02363
• Protein name: DNA-binding protein inhibitor ID-2 (Class B basic helix-loop-helix protein 26) (bHLHb26) (Inhibitor of DNA binding 2) (Inhibitor of differentiation 2)
• Protein function: Transcriptional regulator (lacking a basic DNA binding domain) which negatively regulates the basic helix-loop-helix (bHLH) transcription factors by forming heterodimers and inhibiting their DNA binding and transcriptional activity. Implicated i
• PDB: 4AYA
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00010	HLH	35 → 76	Helix-loop-helix DNA-binding domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in early fetal tissues, including those of the central nervous system.
• Sequence:

  MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVS
  KMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEF
  PSELMSNDSKALCG

• Sequence length: 134

Pathways

KEGG:

TGF-beta signaling pathway
Hippo signaling pathway
Signaling pathways regulating pluripotency of stem cells
Transcriptional misregulation in cancer

Reactome:

NGF-stimulated transcription

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CONGENITAL HEART DISEASE	—	ClinGen, Disgenet ClinGen, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATOLOGIC DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, MYELOID, ACUTE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN DISEASES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN DISEASES, GENETIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SMALL CELL LUNG CARCINOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THYROID DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Myeloid Leukemia (AML-M2)	Leukemia	CTD_human_DG	17330099		★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia, M1	Myeloid Leukemia	CTD_human_DG	17330099		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	LHGDN	15744343		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	29891744		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	29689424		★☆☆☆☆ Found in Text Mining only
Anemia Hemolytic	Hemolytic anemia	Pubtator	36385258	Associate	★☆☆☆☆ Found in Text Mining only
Arsenic Encephalopathy	Arsenic Encephalopathy	CTD_human_DG	16835338		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	17393418	Inhibit	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	22741763		★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	Pubtator	25977194	Associate	★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	18085637		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	27191723	Stimulate	★☆☆☆☆ Found in Text Mining only
Biliary Tract Neoplasms	Biliary tract neoplasms	Pubtator	24409060	Associate	★☆☆☆☆ Found in Text Mining only
Borderline Personality Disorder	Borderline personality disorder	BEFREE	21314245		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	30119050		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	30066902	Stimulate	★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	21314245		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	16877363	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	11572874, 23342268, 24343358	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	14612502		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	20331628, 23403953, 31730902, 37446238	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	35078502	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	24899691	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	22835384, 29866045, 33506299	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	18821033		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	16935894		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	11572874	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	18513385	Stimulate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	26965643, 28767654, 35627268	Associate	★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	17174637		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	22780915	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	25342476		★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	CTD_human_DG	16835338		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	7729604		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	16108844		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	22249557		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	17537156		★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	BEFREE	28678915		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	27385728	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	28678915		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	28678915	Stimulate	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	18000500	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	18000500	Associate	★☆☆☆☆ Found in Text Mining only
GATA2 Deficiency	Gata2 deficiency	Pubtator	18085637, 37032358	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	22380883, 28206987, 28767654, 35149717	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	25773386, 28206987		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	25773386, 28206987		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	21608079, 24425046		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	22380883	Associate	★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Congenital heart defect	Pubtator	28336264	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	17174637		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	LHGDN	16877363, 19099554		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	16877363, 19099554, 26160878	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	18085637	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	25342476		★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	11387483		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	16935894, 25342476		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	LHGDN	18436795		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	26160878, 26965643	Stimulate	★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	15481848, 19937361		★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal Diseases	BEFREE	18085637		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	31751533		★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	18085637		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	16935894		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	20565746, 25644253, 27411580, 8652837	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	20565746, 27411580, 35627268, 36443709	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	CTD_human_DG	17330099		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	28765931		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	17088983, 23403953, 31730902		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	19129913		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	32003423	Inhibit	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	32730703	Inhibit	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	22551584	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	11756183	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	30119050		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	18821033		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	9731481		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	15041724		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28039461		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	23397264	Associate	★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	24343358, 39273240	Associate	★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	28206987	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	11122322, 23566835, 7988087, 8772692		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	22551584	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12447693, 18085637		★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural Tube Defect	BEFREE	21266666		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	12545167, 12670915, 19417068		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	LHGDN	12670915, 15252039		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	15390183, 16705184, 1741406, 25771836	Associate	★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglosphonic dysplasia	BEFREE	29071135		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	38217543	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	28678915	Stimulate	★☆☆☆☆ Found in Text Mining only
Ovarian Failure, Premature	Ovarian Failure	BEFREE	23615648		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	16557592, 18821033		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	27527602	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	9731481		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	18513385	Stimulate	★☆☆☆☆ Found in Text Mining only
Peripheral T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	18085637		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	BEFREE	16935894		★☆☆☆☆ Found in Text Mining only
Primary Cutaneous Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	18085637		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	15041724		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	15041724		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	20002680, 23342267	Associate	★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	12670915		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	7926730	Associate	★☆☆☆☆ Found in Text Mining only
Rett Syndrome	Rett Syndrome	LHGDN	16682435		★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasms	Pubtator	23517130, 27364596	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	LHGDN	12527902		★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	18310898	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	19260835	Stimulate	★☆☆☆☆ Found in Text Mining only
Sarcoma Synovial	Synovial sarcoma	Pubtator	17464317	Associate	★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	CTD_human_DG	23582323		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	29866045	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma	Carcinoma	LHGDN	18000500		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	27807072, 40076972	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	29096401		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	34873426, 35874675	Associate	★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	25299202		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	18085637		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	LHGDN	18085637		★☆☆☆☆ Found in Text Mining only
T-Cell Prolymphocytic Leukemia	T-Cell Prolymphocytic Leukemia	BEFREE	18085637		★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid Diseases	CTD_human_DG	23397585		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	23399020	Stimulate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	35776987	Associate	★☆☆☆☆ Found in Text Mining only
Vasculitis Leukocytoclastic Cutaneous	Vasculitis	Pubtator	18085637	Associate	★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom macroglobulinemia	Pubtator	24801987	Inhibit	★☆☆☆☆ Found in Text Mining only