ID1 (inhibitor of DNA binding 1)

Gene

• Entrez ID: 3397
• Gene name: Inhibitor of DNA binding 1
• Gene symbol: ID1
• Synonyms (NCBI Gene): ID, bHLHb24
• Chromosome: 20
• Chromosome location: 20q11.21
• Summary: The protein encoded by this gene is a helix-loop-helix (HLH) protein that can form heterodimers with members of the basic HLH family of transcription factors. The encoded protein has no DNA binding activity and therefore can inhibit the DNA binding and tr

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT003418	hsa-miR-100-5p	Microarray, qRT-PCR	19396866
MIRT004739	hsa-miR-520h	Microarray, qRT-PCR	19435428
MIRT022546	hsa-miR-124-3p	Microarray	18668037
MIRT024947	hsa-miR-215-5p	Microarray	19074876
MIRT026397	hsa-miR-192-5p	Microarray	19074876
MIRT029333	hsa-miR-26b-5p	Microarray	19088304
MIRT052982	hsa-miR-381-3p	Luciferase reporter assay, qRT-PCR, Western blot	22592211
MIRT052982	hsa-miR-381-3p	HITS-CLIP	24374217
MIRT439157	hsa-let-7c-5p	3'LIFE	25074381
MIRT052982	hsa-miR-381-3p	HITS-CLIP	24374217
MIRT439157	hsa-let-7c-5p	3'LIFE	25074381
MIRT736667	hsa-miR-338-5p	Luciferase reporter assay, Western blotting, qRT-PCR	31646712
MIRT1058947	hsa-miR-1238	CLIP-seq
MIRT1058948	hsa-miR-1253	CLIP-seq
MIRT1058949	hsa-miR-2054	CLIP-seq
MIRT1058950	hsa-miR-29a	CLIP-seq
MIRT1058951	hsa-miR-29b	CLIP-seq
MIRT1058952	hsa-miR-29c	CLIP-seq
MIRT1058953	hsa-miR-300	CLIP-seq
MIRT1058954	hsa-miR-3200-5p	CLIP-seq
MIRT1058955	hsa-miR-330-3p	CLIP-seq
MIRT736667	hsa-miR-338-5p	CLIP-seq
MIRT1058956	hsa-miR-381	CLIP-seq
MIRT1058957	hsa-miR-4251	CLIP-seq
MIRT1058958	hsa-miR-4289	CLIP-seq
MIRT1058959	hsa-miR-4329	CLIP-seq
MIRT1058960	hsa-miR-4666-3p	CLIP-seq
MIRT1058961	hsa-miR-520d-5p	CLIP-seq
MIRT1058962	hsa-miR-524-5p	CLIP-seq
MIRT1058963	hsa-miR-591	CLIP-seq
MIRT1058964	hsa-miR-2355-5p	CLIP-seq
MIRT1058965	hsa-miR-3127-3p	CLIP-seq
MIRT1058966	hsa-miR-4313	CLIP-seq
MIRT2245849	hsa-miR-1275	CLIP-seq
MIRT2245850	hsa-miR-2117	CLIP-seq
MIRT2245851	hsa-miR-3175	CLIP-seq
MIRT2245852	hsa-miR-3197	CLIP-seq
MIRT2245853	hsa-miR-4273	CLIP-seq
MIRT2245854	hsa-miR-4285	CLIP-seq
MIRT2245855	hsa-miR-4287	CLIP-seq
MIRT2245856	hsa-miR-4330	CLIP-seq
MIRT2245857	hsa-miR-4469	CLIP-seq
MIRT2245858	hsa-miR-4525	CLIP-seq
MIRT2245859	hsa-miR-4665-5p	CLIP-seq
MIRT2245860	hsa-miR-4677-5p	CLIP-seq
MIRT2245861	hsa-miR-4685-3p	CLIP-seq
MIRT2245862	hsa-miR-4713-5p	CLIP-seq
MIRT2245863	hsa-miR-4723-5p	CLIP-seq
MIRT2245864	hsa-miR-625	CLIP-seq
MIRT1058947	hsa-miR-1238	CLIP-seq
MIRT1058948	hsa-miR-1253	CLIP-seq
MIRT2245849	hsa-miR-1275	CLIP-seq
MIRT2437683	hsa-miR-1287	CLIP-seq
MIRT2245850	hsa-miR-2117	CLIP-seq
MIRT1058950	hsa-miR-29a	CLIP-seq
MIRT1058951	hsa-miR-29b	CLIP-seq
MIRT1058952	hsa-miR-29c	CLIP-seq
MIRT2245851	hsa-miR-3175	CLIP-seq
MIRT2245852	hsa-miR-3197	CLIP-seq
MIRT1058954	hsa-miR-3200-5p	CLIP-seq
MIRT1058955	hsa-miR-330-3p	CLIP-seq
MIRT2437684	hsa-miR-3652	CLIP-seq
MIRT2437685	hsa-miR-3677-5p	CLIP-seq
MIRT1058957	hsa-miR-4251	CLIP-seq
MIRT2245853	hsa-miR-4273	CLIP-seq
MIRT2245854	hsa-miR-4285	CLIP-seq
MIRT2245855	hsa-miR-4287	CLIP-seq
MIRT2437686	hsa-miR-4323	CLIP-seq
MIRT1058959	hsa-miR-4329	CLIP-seq
MIRT2245856	hsa-miR-4330	CLIP-seq
MIRT2437687	hsa-miR-4430	CLIP-seq
MIRT2245857	hsa-miR-4469	CLIP-seq
MIRT2245858	hsa-miR-4525	CLIP-seq
MIRT2245859	hsa-miR-4665-5p	CLIP-seq
MIRT2245860	hsa-miR-4677-5p	CLIP-seq
MIRT2245861	hsa-miR-4685-3p	CLIP-seq
MIRT2437688	hsa-miR-4690-3p	CLIP-seq
MIRT2245862	hsa-miR-4713-5p	CLIP-seq
MIRT2245863	hsa-miR-4723-5p	CLIP-seq
MIRT1058961	hsa-miR-520d-5p	CLIP-seq
MIRT1058962	hsa-miR-524-5p	CLIP-seq
MIRT1058963	hsa-miR-591	CLIP-seq
MIRT2245864	hsa-miR-625	CLIP-seq
MIRT2451577	hsa-miR-1825	CLIP-seq
MIRT2451578	hsa-miR-4279	CLIP-seq
MIRT2437688	hsa-miR-4690-3p	CLIP-seq
MIRT2451579	hsa-miR-515-3p	CLIP-seq
MIRT2451580	hsa-miR-519e	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
ATF3	Repression	20565867
ATF5	Repression	18701499
CEBPA	Unknown	22568493
POU2F1	Unknown	19212692
TP53	Unknown	16557594
TRIM28	Unknown	21876767
WHSC1	Unknown	16115125
ZNF382	Repression	20682794

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	7665172
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	TAS	14522471
GO:0001525	Process	Angiogenesis	TAS	14522471
GO:0001886	Process	Endothelial cell morphogenesis	IEA
GO:0003714	Function	Transcription corepressor activity	IBA
GO:0005515	Function	Protein binding	IPI	15694377, 17855368, 20211142, 20861012, 21988832, 25609649, 26496610, 32296183, 32814053, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IC	15138269
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	TAS	14522471
GO:0007507	Process	Heart development	IEA
GO:0007623	Process	Circadian rhythm	IEA
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0030182	Process	Neuron differentiation	IBA
GO:0030509	Process	BMP signaling pathway	IEA
GO:0031648	Process	Protein destabilization	IEA
GO:0032963	Process	Collagen metabolic process	IEA
GO:0043408	Process	Regulation of MAPK cascade	IEA
GO:0043433	Process	Negative regulation of DNA-binding transcription factor activity	IDA	15138269
GO:0043534	Process	Blood vessel endothelial cell migration	TAS	14522471
GO:0045668	Process	Negative regulation of osteoblast differentiation	IEA
GO:0045765	Process	Regulation of angiogenesis	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	15138269
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0046677	Process	Response to antibiotic	IEA
GO:0046983	Function	Protein dimerization activity	IEA
GO:0048511	Process	Rhythmic process	IEA
GO:0048514	Process	Blood vessel morphogenesis	TAS	14522471
GO:0060425	Process	Lung morphogenesis	IEA
GO:0060426	Process	Lung vasculature development	IEA
GO:0072577	Process	Endothelial cell apoptotic process	IEA
GO:0120163	Process	Negative regulation of cold-induced thermogenesis	IEA
GO:0120163	Process	Negative regulation of cold-induced thermogenesis	ISS	28270523
GO:0140416	Function	Transcription regulator inhibitor activity	IDA	7665172
GO:0140416	Function	Transcription regulator inhibitor activity	IEA
GO:2000352	Process	Negative regulation of endothelial cell apoptotic process	IEA

Other IDs

• MIM: 600349
• HGNC: 5360
• e!Ensembl: ENSG00000125968

Protein

• UniProt ID: P41134
• Protein name: DNA-binding protein inhibitor ID-1 (Class B basic helix-loop-helix protein 24) (bHLHb24) (Inhibitor of DNA binding 1) (Inhibitor of differentiation 1)
• Protein function: Transcriptional regulator (lacking a basic DNA binding domain) which negatively regulates the basic helix-loop-helix (bHLH) transcription factors by forming heterodimers and inhibiting their DNA binding and transcriptional activity. Implicated i
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00010	HLH	66 → 106	Helix-loop-helix DNA-binding domain	Domain

• Sequence:

  MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQ
  QVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGG
  RGLPVRAPLSTLNGEISALTAEAACVPADDRILCR

• Sequence length: 155

Pathways

KEGG:

Rap1 signaling pathway
TGF-beta signaling pathway
Hippo signaling pathway
Signaling pathways regulating pluripotency of stem cells

Reactome:

Oncogene Induced Senescence
NGF-stimulated transcription

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
DIABETES MELLITUS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, TYPE 2	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	LHGDN	15744343		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	21540238		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	22592211, 23311395, 30563891		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	23308043		★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	BEFREE	19766362, 20189601		★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	19766362		★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	22278018		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	29566125		★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	19766362		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	29508175		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	30861322	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	29508175		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	34052320	Associate	★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	CTD_human_DG	16966095		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	18752043		★☆☆☆☆ Found in Text Mining only
Biliary Tract Neoplasms	Biliary tract neoplasms	Pubtator	24409060	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	LHGDN	16525633		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10728695, 19217708, 21775420, 21955753, 24948111, 26934299		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	18648363, 19419954, 21955753, 24504364, 24948111, 25242400, 32661241	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	30066902	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	12719589, 15999366, 18556654, 19447105, 20574154, 21670698, 23342268, 26858249	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	10728695, 18752043		★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	29039489	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	15999366	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	19567783, 20574154, 22819717, 33834612, 36513250, 37085918, 37446238, 37964494, 37978846	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Lobular	Lobular carcinoma	Pubtator	32661241	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	20709421, 22592211, 28549790, 30949224		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	33178820	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	12576450		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	36582228	Associate	★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	31545447		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	19359031, 21670698, 31545447		★☆☆☆☆ Found in Text Mining only
Cholesteatoma	Cholesteatoma	Pubtator	18347258	Associate	★☆☆☆☆ Found in Text Mining only
Cholesteatoma Middle Ear	Middle ear cholesteatoma	Pubtator	18347258, 20887552	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	30887652		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	18513385, 30887652, 30994840	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	26821069, 31440083		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	18202790, 19014499		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	19014499, 19798702, 21554132, 28510612, 28767654, 34841646, 37996458	Associate	★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	24434151		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	28270523		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	28270523		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	CTD_human_DG	16123366		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ductal Carcinoma	Ductal Carcinoma	BEFREE	10728695		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	25207642, 26577912, 36232817	Associate	★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	12576450		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	LHGDN	16506209		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	18000500, 21896993, 26858249	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	18000500	Stimulate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	21896993, 26858249, 37607071	Associate	★☆☆☆☆ Found in Text Mining only
Fibrodysplasia Ossificans Progressiva	Fibrodysplasia Ossificans Progressiva	BEFREE	30417373		★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	28611292	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	28767654, 39938577	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	29208670, 31292163		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	29208670, 31292163		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	23243024		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	27065332	Associate	★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	15579766		★☆☆☆☆ Found in Text Mining only
Hemangioma	Hemangioma	BEFREE	28587325, 30584986		★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	18648363	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension Pulmonary	Pulmonary hypertension	Pubtator	16840720	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	LHGDN	18436795		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	16840720	Inhibit	★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	29449428, 30453304		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	29328430		★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	LHGDN	12719589		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	22278018		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	27127787		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	18559972, 24130053, 26944543		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	18559972		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	19643984, 35806401, 37032592	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	19643984, 26191235, 27784745	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	36443709	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	26944543		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelomonocytic, Chronic	Myelomonocytic Leukemia	BEFREE	31640815		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	12949053, 26330493, 29169374		★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	BEFREE	31515741		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	26330493		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	32003423, 35897813	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	22966240	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	19491902, 30994840, 37416767	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	20574154, 30066902	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	26330493		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10728695, 19217708, 21775420, 21955753, 24948111, 26934299		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	26330493		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	22592211, 28549790, 30949224		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	12576450		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11992094, 18072288, 18497083, 18752043, 20881502, 24129125		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	16184548, 27610466, 28529558		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	15579766		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	16115125, 16525633, 17565736, 19359031, 20484992, 21467165, 24130053, 26330493, 27546618, 28529558, 29208670, 30949224, 31292163, 31440083		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	CTD_human_DG	16966095		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	31545447		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	11896613, 16469432, 18158619, 18413773, 18648363		★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	11114629		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	16189525, 17565736, 20484992, 21147226, 21467165		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	16189525, 17565736		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	16189525, 20484992, 33744299, 39273240	Associate	★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	18240291	Stimulate	★☆☆☆☆ Found in Text Mining only
Moyamoya Disease	Moyamoya disease	Pubtator	39948449	Associate	★☆☆☆☆ Found in Text Mining only
Multinodular goiter	Multinodular goiter	BEFREE	15579766		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	16115125		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	16115125, 37042949	Associate	★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	19644139	Associate	★☆☆☆☆ Found in Text Mining only
MYELOPROLIFERATIVE DISORDER, CHRONIC, WITH EOSINOPHILIA	Myeloproliferative Disorder with Eosinophilia	BEFREE	21540238		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	CTD_human_DG	16214533		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myositis Ossificans	Myositis	Pubtator	16753021, 30417373	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15579766, 16184548, 18752043, 19359031, 19491902, 20484992, 21688151, 22076920, 22364398, 23311395, 24129125, 27998768, 29039489, 29566125, 29748374		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	CTD_human_DG	16966095		★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural Tube Defect	BEFREE	15345369		★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural tube defect	Pubtator	19644139	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	21506108	Associate	★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	20709421, 21540238, 23311395, 28549790, 31337979, 31355336		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	28270523		★☆☆☆☆ Found in Text Mining only
Oropharyngeal Neoplasms	Oropharyngeal neoplasm	Pubtator	37759448	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	27208419	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	12576450		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	15599381, 19447105, 20003244, 20796276, 20842131, 23714001, 24662327, 27424980	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	15026801		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	15026801	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	18513385	Stimulate	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	12947323		★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	31582374		★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	19491902	Associate	★☆☆☆☆ Found in Text Mining only
Polymorphous corneal dystrophy	Polymorphous corneal dystrophy	BEFREE	15725882		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	11992094, 18072288, 18497083, 18752043, 20881502, 24129125		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	12016143, 14688027, 15041724, 16287090, 17855368, 18072288		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	12057920	Inhibit	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	17855368, 18752043, 20388787, 22564737, 23060149, 23342267, 23342268, 24122992, 25031707	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	14690332		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	LHGDN	14690332		★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	18436795, 31922883	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	18583319		★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	30861322		★☆☆☆☆ Found in Text Mining only
Rett Syndrome	Rett Syndrome	LHGDN	16682435		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	11394898, 30861322		★☆☆☆☆ Found in Text Mining only
Sacral defect and anterior sacral meningocele	Sacral defect	Pubtator	35274497	Associate	★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasms	Pubtator	23517130, 27364596	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	12719589	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	12787042, 18000500		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	21540238		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	16184548, 27610466, 28529558		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	15161041, 19491902, 22245935, 23900621	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	16271072		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	35635748	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	15579766		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	LHGDN	12947323, 15579766, 16029118		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	15579766		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	22821892, 24069422	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	32768930	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasm	Uterine cervix neoplasm	LHGDN	19002177		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	19002177, 21670698, 26072160	Associate	★☆☆☆☆ Found in Text Mining only