Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	339559
Gene name	ZFP69 zinc finger protein
Gene symbol	ZFP69
Synonyms (NCBI Gene)	ZFP69AZKSCAN23AZNF642ZSCAN54A
Chromosome	1
Chromosome location	1p34.2

Show/Hide all (1)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017085	hsa-miR-335-5p	Microarray	18185580

Show/Hide all (14)

GO ID	Ontology	Definition	Evidence
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0003677	Function	DNA binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0019216	Process	Regulation of lipid metabolic process	IEA
GO:0019216	Process	Regulation of lipid metabolic process	ISS
GO:0031981	Component	Nuclear lumen	IEA
GO:0046872	Function	Metal ion binding	IEA

MIM	HGNC	e!Ensembl
617939	24708	ENSG00000187815

Q49AA0

Protein name

Zinc finger protein 69 homolog (Zinc finger protein 642)

Protein function

Putative transcription factor that appears to regulate lipid metabolism.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01352	KRAB	75 → 116	KRAB box	Family
PF00096	zf-C2H2	271 → 293	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	299 → 321	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	327 → 349	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	355 → 377	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	383 → 405	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	439 → 461	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	495 → 517	Zinc finger, C2H2 type	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in visceral and subcutaneous adipose tissue. {ECO:0000269|PubMed:19578398}.

Sequence

MPQQLLITLPTEASTWVKLQHPKKAVEGAPLWEDVTKMFEGEALLSQDAEDVKTQRESLE
DEVTPGLPTAESQELLTFKDISIDFTQEEWGQLAPAHQNLYREVMLENYSNLVSVGYQLS
KPSVISQLEKGEEPWMAEKEGPGDPSSDLKSKIETIESTAKSTISQERLYHGIMMESFMR
DDIIYSTLRKVSTYDDVLERHQETCMRDVRQAILTHKKRVQETNKFGENIIVHSNVIIEQ
RHHKYDTPTKRNTYKLDLINHPTSYIRTKTYECNICEKIFKQPIHLTEHMRIHTGEKPFR
CKECGRAFSQSASLSTHQRIHTGEKPFECEECGKAFRHRSSLNQHHRTHTGEKPYVCDKC
QKAFSQNISLVQHLRTHSGEKPFTCNECGKTFRQIRHLSEHIRIHTGEKPYACTACCKTF
SHRAYLTHHQRIHTGERPYKCKECGKAFRQRIHLSNHKTVHTGVKAYECNRCGKAYRHDS
SFKKHQRHHTGEKPYECNECGKAFSYNSSLSRHHEIHRRNAFRNKV

Sequence length

526

Interactions

View interactions

	Reactome
			Generic Transcription Pathway

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (2)

Disease Name	Disease (Merged)	Source	PMID	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	19578398	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	19578398	★★★★★ ★☆☆☆☆ Found in Text Mining only

ZFP69 (ZFP69 zinc finger protein)