Gene Gene information from NCBI Gene database.
Entrez ID 339390
Gene name C-type lectin domain family 4 member G
Gene symbol CLEC4G
Synonyms (NCBI Gene)
DTTR431LP2698LSECtinUNQ431
Chromosome 19
Chromosome location 19p13.2
Summary This gene encodes a glycan-binding receptor and member of the C-type lectin family which plays a role in the immune response. C-type lectin receptors are pattern recognition receptors located on immune cells that play a role in the recognition and uptake
miRNA miRNA information provided by mirtarbase database.
28
miRTarBase ID miRNA Experiments Reference
MIRT025828 hsa-miR-7-5p Microarray 17612493
MIRT896110 hsa-miR-1321 CLIP-seq
MIRT896111 hsa-miR-1587 CLIP-seq
MIRT896112 hsa-miR-3147 CLIP-seq
MIRT896113 hsa-miR-3652 CLIP-seq
Transcription factors Transcription factors information provided by TRRUST V2 database.
3
Transcription factor Regulation Reference
MYB Activation 19111020
RUNX3 Activation 19111020
SPI1 Activation 19111020
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
27
GO ID Ontology Definition Evidence Reference
GO:0001618 Function Virus receptor activity IDA 22156524
GO:0001618 Function Virus receptor activity IEA
GO:0002456 Process T cell mediated immunity IEA
GO:0002710 Process Negative regulation of T cell mediated immunity IEA
GO:0005515 Function Protein binding IPI 18624398, 32296183, 33106485
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
616256 24591 ENSG00000182566
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6UXB4
Protein name C-type lectin domain family 4 member G (Liver and lymph node sinusoidal endothelial cell C-type lectin) (LSECtin)
Protein function Binds mannose, N-acetylglucosamine (GlcNAc) and fucose, but not galactose, in a Ca(2+)-dependent manner, in vitro. ; (Microbial infection) Acts as a receptor for Japanese encephalitis virus. {ECO:0000269|P
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00059 Lectin_C 182 289 Lectin C-type domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed exclusively in fetal and adult liver and in lymph nodes. Specifically expressed by endothelial cells lining lymph node and liver sinuses (at protein level). {ECO:0000269|PubMed:14711836}.
Sequence
MDTTRYSKWGGSSEEVPGGPWGRWVHWSRRPLFLALAVLVTTVLWAVILSILLSKASTER
AALLDGHDLLRTNASKQTAALGALKEEVGDCHSCCSGTQAQLQTTRAELGEAQAKLMEQE
SALRELRERVTQGLAEAGRGREDVRTELFRALEAVRLQNNSCEPCPTSWLSFEGSCYFFS
VPKTTWAAAQDHCADASAHLVIVGGLDEQGFLTRNTRGRGYWLGLRAVRHLGKVQGYQWV
DGVSLSFSHWNQGEPNDAWGRENCVMMLHTGLWNDAPCDSEKDGWICEK
RHNC
Sequence length 293
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
CARCINOMA, HEPATOCELLULAR CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Breast Carcinoma Breast Carcinoma BEFREE 30858559
★☆☆☆☆
Found in Text Mining only
Carcinoma, Basal Cell Carcinoma BEFREE 30858559
★☆☆☆☆
Found in Text Mining only
Liver carcinoma Liver carcinoma CTD_human_DG 28284560
★☆☆☆☆
Found in Text Mining only
Lymphatic Metastasis Lymphatic metastasis Pubtator 35821222 Associate
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of breast Breast Cancer BEFREE 30858559
★☆☆☆☆
Found in Text Mining only
Myelodysplastic Syndromes Myelodysplastic syndrome Pubtator 35283406 Associate
★☆☆☆☆
Found in Text Mining only
Nasal Polyps Nasal polyp Pubtator 37085563 Associate
★☆☆☆☆
Found in Text Mining only
Stomach Neoplasms Stomach neoplasms Pubtator 33611641, 35821222 Associate
★☆☆☆☆
Found in Text Mining only