TMEM95 (transmembrane protein 95)

Gene

• Entrez ID: 339168
• Gene name: Transmembrane protein 95
• Gene symbol: TMEM95
• Synonyms (NCBI Gene): UNQ9390
• Chromosome: 17
• Chromosome location: 17p13.1

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT2131649	hsa-miR-298	CLIP-seq
MIRT2131650	hsa-miR-3154	CLIP-seq
MIRT2131651	hsa-miR-3179	CLIP-seq
MIRT2131652	hsa-miR-578	CLIP-seq
MIRT2352982	hsa-miR-1229	CLIP-seq
MIRT2352983	hsa-miR-4528	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002080	Component	Acrosomal membrane	IBA
GO:0002080	Component	Acrosomal membrane	IEA
GO:0002080	Component	Acrosomal membrane	ISS
GO:0005515	Function	Protein binding	IPI	32296183, 32814053
GO:0007338	Process	Single fertilization	IEA
GO:0007342	Process	Fusion of sperm to egg plasma membrane involved in single fertilization	IBA
GO:0007342	Process	Fusion of sperm to egg plasma membrane involved in single fertilization	IEA
GO:0007342	Process	Fusion of sperm to egg plasma membrane involved in single fertilization	IMP	36161911
GO:0007342	Process	Fusion of sperm to egg plasma membrane involved in single fertilization	ISS
GO:0016020	Component	Membrane	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0097524	Component	Sperm plasma membrane	IEA

Other IDs

• MIM: 617814
• HGNC: 27898
• e!Ensembl: ENSG00000182896

Protein

• UniProt ID: Q3KNT9
• Protein name: Sperm-egg fusion protein TMEM95 (Transmembrane protein 95)
• Protein function: Sperm protein required for fusion of sperm with the egg membrane during fertilization.
• PDB: 7UX0
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15203	TMEM95	17 → 167	TMEM95 family	Family

• Tissue specificity: TISSUE SPECIFICITY: Spermatozoa (at protein level). {ECO:0000269|PubMed:36161911}.
• Sequence:

  MWRLALGGVFLAAAQACVFCRLPAHDLSGRLARLCSQMEARQKECGASPDFSAFALDEVS
  MNKVTEKTHRVLRVMEIKEAVSSLPSYWSWLRKTKLPEYTREALCPPACRGSTTLYNCST
  CKGTEVSCWPRKRCFPGSQDLWEAKILLLSIFGAFLLLGVLSLLVESHHLQAKSGL

• Sequence length: 176

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
UTERINE FIBROID	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations