ST8SIA6 (ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 6)

Gene

• Entrez ID: 338596
• Gene name: ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 6
• Gene symbol: ST8SIA6
• Synonyms (NCBI Gene): SIA8F, SIAT8-F, SIAT8F, ST8SIA-VI, ST8SiaVI
• Chromosome: 10
• Chromosome location: 10p12.33
• Summary: This gene encodes a member of the glycosyltransferase 29 protein family. Members of this protein family synthesize sialylglycoconjugates. Sialylation may contribute to multidrug resistance in cancer cells. Alternative splicing results in multiple transcri

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT2118339	hsa-miR-133a	CLIP-seq
MIRT2118340	hsa-miR-133b	CLIP-seq
MIRT2118341	hsa-miR-4271	CLIP-seq
MIRT2118342	hsa-miR-4725-3p	CLIP-seq
MIRT2118343	hsa-miR-9	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0000139	Component	Golgi membrane	TAS
GO:0001574	Process	Ganglioside biosynthetic process	IEA
GO:0001574	Process	Ganglioside biosynthetic process	ISS	11980897
GO:0001835	Process	Blastocyst hatching	IEA
GO:0003828	Function	Alpha-N-acetylneuraminate alpha-2,8-sialyltransferase activity	IBA
GO:0003828	Function	Alpha-N-acetylneuraminate alpha-2,8-sialyltransferase activity	TAS
GO:0005794	Component	Golgi apparatus	IEA
GO:0006486	Process	Protein glycosylation	IBA
GO:0006486	Process	Protein glycosylation	IEA
GO:0006491	Process	N-glycan processing	IBA
GO:0006493	Process	Protein O-linked glycosylation	IEA
GO:0006493	Process	Protein O-linked glycosylation	ISS	11980897
GO:0006629	Process	Lipid metabolic process	IEA
GO:0008373	Function	Sialyltransferase activity	IEA
GO:0008373	Function	Sialyltransferase activity	ISS	11980897
GO:0009100	Process	Glycoprotein metabolic process	IEA
GO:0009100	Process	Glycoprotein metabolic process	ISS	11980897
GO:0009247	Process	Glycolipid biosynthetic process	IEA
GO:0009247	Process	Glycolipid biosynthetic process	ISS	11980897
GO:0009311	Process	Oligosaccharide metabolic process	IBA
GO:0009311	Process	Oligosaccharide metabolic process	IEA
GO:0009311	Process	Oligosaccharide metabolic process	ISS	11980897
GO:0016020	Component	Membrane	IEA
GO:0016051	Process	Carbohydrate biosynthetic process	IEA
GO:0016051	Process	Carbohydrate biosynthetic process	ISS	11980897
GO:0016740	Function	Transferase activity	IEA
GO:0016757	Function	Glycosyltransferase activity	IEA

Other IDs

• MIM: 610139
• HGNC: 23317
• e!Ensembl: ENSG00000148488

Protein

• UniProt ID: P61647
• Protein name: Alpha-2,8-sialyltransferase 8F (EC 2.4.99.-) (Sialyltransferase 8F) (SIAT8-F) (Sialyltransferase St8Sia VI) (ST8SiaVI)
• Protein function: Alpha-2,8-sialyltransferase that prefers O-glycans to N-glycans or glycolipids as acceptor substrates. The minimal acceptor substrate is the NeuAc-alpha-2,3(6)-Gal sequence at the non-reducing end of their carbohydrate groups. {ECO:0000250|UniPr
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00777	Glyco_transf_29	138 → 392	Glycosyltransferase family 29 (sialyltransferase)	Family

• Sequence:

  MRPGGALLALLASLLLLLLLRLLWCPADAPGRARILVEESREATHGTPAALRTLRSPATA
  VPRATNSTYLNEKSLQLTEKCKNLQYGIESFSNKTKGYSENDYLQIITDIQSCPWKRQAE
  EYANFRAKLASCCDAVQNFVVSQNNTPVGTNMSYEVESKKEIPIKKNIFHMFPVSQPFVD
  YPYNQCAVVGNGGILNKSLCGTEIDKSDFVFRCNLPPTTGDVSKDVGSKTNLVTINPSII
  TLKYGNLKEKKALFLEDIATYGDAFFLLPAFSFRANTGTSFKVYYTLEESKARQKVLFFH
  PKYLKDLALFWRTKGVTAYRLSTGLMITSVAVELCKNVKLYGFWPFSKTVEDIPVSHHYY
  DNKLPKHGFHQMPKEYSQILQLHMKGILKLQFSKCEVA

• Sequence length: 398

Pathways

Reactome:

Sialic acid metabolism
N-Glycan antennae elongation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
HUNTINGTON DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTROPHIC CARDIOMYOPATHY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate cancer	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Breast Neoplasms	Breast neoplasm	Pubtator	30150751, 34894405, 36591654	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	26516143, 33416148, 36635290	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	32373956	Stimulate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	39898245	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	33416148	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	27490539	Associate	★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	GWASCAT_DG	19176441		★☆☆☆☆ Found in Text Mining only