Gene Gene information from NCBI Gene database.
Entrez ID 338567
Gene name Potassium two pore domain channel subfamily K member 18
Gene symbol KCNK18
Synonyms (NCBI Gene)
K2p18.1MGR13TRESKTRESK-2TRESK2TRIK
Chromosome 10
Chromosome location 10q25.3
Summary Potassium channels play a role in many cellular processes including maintenance of the action potential, muscle contraction, hormone secretion, osmotic regulation, and ion flow. This gene encodes a member of the superfamily of potassium channel proteins c
SNPs SNP information provided by dbSNP.
2
SNP ID Visualize variation Clinical significance Consequence
rs541915908 ->T Benign, likely-pathogenic Frameshift variant, coding sequence variant
rs869025175 CT>- Risk-factor, likely-pathogenic Coding sequence variant, frameshift variant
miRNA miRNA information provided by mirtarbase database.
1
miRTarBase ID miRNA Experiments Reference
MIRT023160 hsa-miR-124-3p Microarray 18668037
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
23
GO ID Ontology Definition Evidence Reference
GO:0005267 Function Potassium channel activity IEA
GO:0005886 Component Plasma membrane IBA
GO:0005886 Component Plasma membrane IC 12754259
GO:0005886 Component Plasma membrane IDA 20006580
GO:0005886 Component Plasma membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
613655 19439 ENSG00000186795
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q7Z418
Protein name Potassium channel subfamily K member 18 (TWIK-related individual potassium channel) (TWIK-related spinal cord potassium channel)
Protein function K(+) channel that conducts outward and inward rectifying currents at depolarized and hyperpolarized membrane potentials, respectively. The outward rectifying currents are voltage-dependent, coupled to K(+) electrochemical gradient across the mem
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07885 Ion_trans_2 88 157 Ion channel Family
PF07885 Ion_trans_2 286 364 Ion channel Family
Tissue specificity TISSUE SPECIFICITY: Expressed in dorsal root ganglion and trigeminal ganglion neurons. Detected at low levels in spinal cord. Expressed in regulatory T cells (at protein level). {ECO:0000269|PubMed:12754259, ECO:0000269|PubMed:15562060, ECO:0000269|PubMed
Sequence
MEVSGHPQARRCCPEALGKLFPGLCFLCFLVTYALVGAVVFSAIEDGQVLVAADDGEFEK
FLEELCRILNCSETVVEDRKQDLQGHLQKVKPQWFNRTTHWSFLSSLFFCCTVFSTVGYG
YIYPVTRLGKYLCMLYALFGIPLMFLVLTDTGDILAT
ILSTSYNRFRKFPFFTRPLLSKW
CPKSLFKKKPDPKPADEAVPQIIISAEELPGPKLGTCPSRPSCSMELFERSHALEKQNTL
QLPPQAMERSNSCPELVLGRLSYSIISNLDEVGQQVERLDIPLPIIALIVFAYISCAAAI
LPFWETQLDFENAFYFCFVTLTTIGFGDTVLEHPNFFLFFSIYIIVGMEIVFIAFKLVQN
RLID
IYKNVMLFFAKGKFYHLVKK
Sequence length 384
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    TWIK-related spinal cord K+ channel (TRESK)
Phase 4 - resting membrane potential
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
8
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
KCNK18-related neurodevelopmental disorder Pathogenic rs146194900 RCV002509910
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Migraine, with or without aura, susceptibility to, 13 Pathogenic rs2493501187 RCV002465408
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
KCNK18-related disorder Benign; Likely benign; Uncertain significance; Conflicting classifications of pathogenicity ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDERS Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
MIGRAINE WITH AURA, SUSCEPTIBILITY TO, 13 CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Parkinson disease Conflicting classifications of pathogenicity ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Autism Spectrum Disorder Autism Pubtator 37195340 Associate
★☆☆☆☆
Found in Text Mining only
Common Migraine Common Migraine BEFREE 25324165, 26747084
★☆☆☆☆
Found in Text Mining only
Developmental Disabilities Developmental disability Pubtator 37195340 Associate
★☆☆☆☆
Found in Text Mining only
Diabetic Neuropathies Diabetic neuropathy Pubtator 36430572 Associate
★☆☆☆☆
Found in Text Mining only
Epilepsy Epilepsy Pubtator 37195340 Associate
★☆☆☆☆
Found in Text Mining only
Hemiplegic migraine, familial type 1 Hemiplegic migraine BEFREE 26747084
★☆☆☆☆
Found in Text Mining only
Intellectual Disability Intellectual developmental disorder Pubtator 37195340 Associate
★☆☆☆☆
Found in Text Mining only
Malignant Neoplasms Malignant Neoplasm BEFREE 30818127
★☆☆☆☆
Found in Text Mining only
Migraine Disorders Migraine BEFREE 20871611, 21855646, 23030542, 23911303, 23919895, 25324165, 26747084, 28255817, 28389699, 29973548, 30573346, 30653930, 30979812, 31742594
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Migraine Disorders Migraine Pubtator 26747084, 30653930 Associate
★★☆☆☆
Found in Text Mining + Unknown/Other Associations