ANO9 (anoctamin 9)

Gene

• Entrez ID: 338440
• Gene name: Anoctamin 9
• Gene symbol: ANO9
• Synonyms (NCBI Gene): PIG5, TMEM16J, TP53I5
• Chromosome: 11
• Chromosome location: 11p15.5
• Summary: The protein encoded by this gene is a member of the TMEM16 (anoctamin) family of proteins, some of which form integral membrane calcium-activated chloride channels. The function of the encoded protein has yet to be elucidated, although it may have channel

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT785907	hsa-miR-1233	CLIP-seq
MIRT785908	hsa-miR-3150b-3p	CLIP-seq
MIRT785909	hsa-miR-4474-3p	CLIP-seq
MIRT785910	hsa-miR-4687-5p	CLIP-seq
MIRT785911	hsa-miR-4689	CLIP-seq
MIRT785912	hsa-miR-4784	CLIP-seq
MIRT785913	hsa-miR-544b	CLIP-seq
MIRT785914	hsa-miR-604	CLIP-seq
MIRT785915	hsa-miR-647	CLIP-seq
MIRT1931848	hsa-miR-138	CLIP-seq
MIRT1931849	hsa-miR-3179	CLIP-seq
MIRT1931850	hsa-miR-323-5p	CLIP-seq
MIRT1931851	hsa-miR-4456	CLIP-seq
MIRT785915	hsa-miR-647	CLIP-seq
MIRT1931852	hsa-miR-876-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005229	Function	Intracellularly calcium-gated chloride channel activity	IDA	21984732, 22178883
GO:0005229	Function	Intracellularly calcium-gated chloride channel activity	IMP	22946059
GO:0005254	Function	Chloride channel activity	IBA
GO:0005254	Function	Chloride channel activity	TAS
GO:0005262	Function	Calcium channel activity	IEA
GO:0005262	Function	Calcium channel activity	IMP	36520003
GO:0005515	Function	Protein binding	IPI	21525870, 24550280, 32296183
GO:0005783	Component	Endoplasmic reticulum	IDA	36520003
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	22946059, 29604966
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006869	Process	Lipid transport	IEA
GO:0007608	Process	Sensory perception of smell	IEA
GO:0015267	Function	Channel activity	IDA	29604966
GO:0015267	Function	Channel activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0017128	Function	Phospholipid scramblase activity	IEA
GO:0019869	Function	Chloride channel inhibitor activity	IDA	22946059
GO:0034220	Process	Monoatomic ion transmembrane transport	TAS
GO:0046983	Function	Protein dimerization activity	IEA
GO:0051649	Process	Establishment of localization in cell	IEA
GO:0061589	Process	Calcium activated phosphatidylserine scrambling	IEA
GO:0061590	Process	Calcium activated phosphatidylcholine scrambling	IEA
GO:0061591	Process	Calcium activated galactosylceramide scrambling	IEA
GO:0070588	Process	Calcium ion transmembrane transport	IEA
GO:1902476	Process	Chloride transmembrane transport	IBA
GO:1902476	Process	Chloride transmembrane transport	IMP	22946059

Other IDs

• MIM: 619963
• HGNC: 20679
• e!Ensembl: ENSG00000185101

Protein

• UniProt ID: A1A5B4
• Protein name: Anoctamin-9 (Transmembrane protein 16J) (Tumor protein p53-inducible protein 5) (p53-induced gene 5 protein)
• Protein function: PKA-activated nonselective cation channel (PubMed:29604966). Discriminates poorly among cations but is more permeable to Ca(2+) ions than to monovalent cations (By similarity). Acts as a calcium-activated calcium permeable channel which may oper
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF04547	Anoctamin	179 → 738	Calcium-activated chloride channel	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in the kidney (PubMed:36520003). Expressed in the olfactory epithelium (PubMed:36330924). {ECO:0000269|PubMed:36330924, ECO:0000269|PubMed:36520003}.
• Sequence:

  MQGEESLRILVEPEGDSFPLMEISTCETEASEQWDYVLVAQRHTQRDPRQARQQQFLEEL
  RRKGFHIKVIRDQKQVFFGIRADNSVFGLYRTLLLEPEGPAPHAELAAPTTIPVTTSLRI
  RIVNFVVMNNKTSAGETFEDLMKDGVFEARFPLHKGEGRLKKTWARWRHMFREQPVDEIR
  NYFGEKVALYFVWLGWYTYMLVPAALTGLLVFLSGFSLFEASQISKEICEAHDILMCPLG
  DHSRRYQRLSETCTFAKLTHLFDNDGTVVFAIFMALWATVFLEIWKRQRARVVLHWDLYV
  WDEEQEEMALQLINCPDYKLRPYQHSYLRSTVILVLTLLMICLMIGMAHVLVVYRVLASA
  LFSSSAVPFLEEQVTTAVVVTGALVHYVTIIIMTKINRCVALKLCDFEMPRTFSERESRF
  TIRFFTLQFFTHFSSLIYIAFILGRINGHPGKSTRLAGLWKLEECHASGCMMDLFVQMAI
  IMGLKQTLSNCVEYLVPWVTHKCRSLRASESGHLPRDPELRDWRRNYLLNPVNTFSLFDE
  FMEMMIQYGFTTIFVAAFPLAPLLALFSNLVEIRLDAIKMVWLQRRLVPRKAKDIGTWLQ
  VLETIGVLAVIANGMVIAFTSEFIPRVVYKYRYSPCLKEGNSTVDCLKGYVNHSLSVFHT
  KDFQDPDGIEGSENVTLCRYRDYRNPPDYNFSEQFWFLLAIRLAFVILFEHVALCIKLIA
  AWFVPDIPQSVKNKVLEVKYQRLREKMWHGRQRLGGVGAGSRPPMPAHPTPASIFSARST
  DV

• Sequence length: 782

Pathways

KEGG:

Efferocytosis

Reactome:

Stimuli-sensing channels

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BREAST CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CUTANEOUS MELANOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METASTATIC COLORECTAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate cancer	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Colorectal Carcinoma	Colorectal Cancer	BEFREE	26317553		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	26317553	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	29024940		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	29024940		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	33404124	Associate	★☆☆☆☆ Found in Text Mining only