Gene Gene information from NCBI Gene database.
Entrez ID 338339
Gene name C-type lectin domain family 4 member D
Gene symbol CLEC4D
Synonyms (NCBI Gene)
CD368CLEC-6CLEC6CLECSF8Dectin-3MCLMPCL
Chromosome 12
Chromosome location 12p13.31
Summary This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles
miRNA miRNA information provided by mirtarbase database.
282
miRTarBase ID miRNA Experiments Reference
MIRT021599 hsa-miR-142-3p Microarray 17612493
MIRT049934 hsa-miR-30a-5p CLASH 23622248
MIRT611584 hsa-miR-8485 HITS-CLIP 23824327
MIRT611583 hsa-miR-329-3p HITS-CLIP 23824327
MIRT611582 hsa-miR-362-3p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
30
GO ID Ontology Definition Evidence Reference
GO:0002250 Process Adaptive immune response IEA
GO:0002250 Process Adaptive immune response IEA
GO:0002292 Process T cell differentiation involved in immune response IEA
GO:0002376 Process Immune system process IEA
GO:0005515 Function Protein binding IPI 23911656, 25910212, 32296183
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
609964 14554 ENSG00000166527
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8WXI8
Protein name C-type lectin domain family 4 member D (C-type lectin superfamily member 8) (C-type lectin-like receptor 6) (CLEC-6) (Dendritic cell-associated C-type lectin 3) (DC-associated C-type lectin 3) (Dectin-3) (CD antigen CD368)
Protein function Calcium-dependent lectin that acts as a pattern recognition receptor (PRR) of the innate immune system: recognizes damage-associated molecular patterns (DAMPs) of pathogen-associated molecular patterns (PAMPs) of bacteria and fungi (PubMed:23602
PDB 2LS8 , 3WHD
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00059 Lectin_C 101 209 Lectin C-type domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed weakly in peripheral blood leukocytes, bone marrow and spleen. Expression is confined mostly in monocytes and macrophage and seems to be up-regulated by IL-6, IL-10, TNF-alpha and IFN-gamma. {ECO:0000269|PubMed:14971047}.
Sequence
MGLEKPQSKLEGGMHPQLIPSVIAVVFILLLSVCFIASCLVTHHNFSRCKRGTGVHKLEH
HAKLKCIKEKSELKSAEGSTWNCCPIDWRAFQSNCYFPLTDNKTWAESERNCSGMGAHLM
TISTEAEQNFIIQFLDRRLSYFLGLRDENAKGQWRWVDQTPFNPRRVFWHKNEPDNSQGE
NCVVLVYNQDKWAWNDVPCNFEASRICKI
PGTTLN
Sequence length 215
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  C-type lectin receptor signaling pathway   Dectin-2 family
Neutrophil degranulation
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
LUNG DISEASES CTD, Disgenet
CTD, Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Acute lymphocytic leukemia Lymphocytic Leukemia BEFREE 12537975
★☆☆☆☆
Found in Text Mining only
Acute Promyelocytic Leukemia Promyelocytic Leukemia BEFREE 14646600
★☆☆☆☆
Found in Text Mining only
Adult Acute Lymphocytic Leukemia Lymphocytic Leukemia BEFREE 12537975
★☆☆☆☆
Found in Text Mining only
Allergic rhinitis (disorder) Allergic rhinitis BEFREE 24094722
★☆☆☆☆
Found in Text Mining only
Aortic Dissection Aortic dissection Pubtator 35178459 Associate
★☆☆☆☆
Found in Text Mining only
Arteriosclerosis Arteriosclerosis BEFREE 30867470
★☆☆☆☆
Found in Text Mining only
Atherosclerosis Atherosclerosis BEFREE 30867470
★☆☆☆☆
Found in Text Mining only
Autoimmune Diseases Autoimmune Diseases BEFREE 31725411
★☆☆☆☆
Found in Text Mining only
B-Cell Lymphomas B-Cell Lymphoma BEFREE 29545910, 29632722, 8897513
★☆☆☆☆
Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE Lymphocytic Leukemia BEFREE 10397742
★☆☆☆☆
Found in Text Mining only