Gene Gene information from NCBI Gene database.
Entrez ID 338324
Gene name S100 calcium binding protein A7A
Gene symbol S100A7A
Synonyms (NCBI Gene)
NICE-2NICE2S100A15S100A7L1S100A7f
Chromosome 1
Chromosome location 1q21.3
miRNA miRNA information provided by mirtarbase database.
152
miRTarBase ID miRNA Experiments Reference
MIRT030254 hsa-miR-26b-5p Microarray 19088304
MIRT646032 hsa-miR-216b-5p HITS-CLIP 23824327
MIRT646031 hsa-miR-130b-5p HITS-CLIP 23824327
MIRT646030 hsa-miR-3167 HITS-CLIP 23824327
MIRT646029 hsa-miR-876-5p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
11
GO ID Ontology Definition Evidence Reference
GO:0005509 Function Calcium ion binding IBA
GO:0005509 Function Calcium ion binding IEA
GO:0005515 Function Protein binding IPI 32296183
GO:0005737 Component Cytoplasm IBA
GO:0005737 Component Cytoplasm IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
617427 21657 ENSG00000184330
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q86SG5
Protein name Protein S100-A7A (S100 calcium-binding protein A15) (S100 calcium-binding protein A7-like 1) (S100 calcium-binding protein A7A)
Protein function May be involved in epidermal differentiation and inflammation and might therefore be important for the pathogenesis of psoriasis and other diseases.
PDB 4AQI
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01023 S_100 6 45 S-100/ICaBP type calcium binding domain Domain
Tissue specificity TISSUE SPECIFICITY: Overexpressed in psoriasis.
Sequence
MSNTQAERSIIGMIDMFHKYTGRDGKIEKPSLLTMMKENFPNFLSACDKKGIHYLATVFE
KKDKNEDKKIDFSEFLSLLGDIAADYHKQSHGAAPCSGGSQ
Sequence length 101
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  IL-17 signaling pathway   Metal sequestration by antimicrobial proteins
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
MASTOCYTOSIS GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
POLYCYSTIC OVARY SYNDROME CTD, Disgenet
CTD, Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Acne Acne BEFREE 31639246
★☆☆☆☆
Found in Text Mining only
Acne Vulgaris Acne BEFREE 31639246
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma Adenocarcinoma BEFREE 28498804
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma of lung (disorder) Lung adenocarcinoma BEFREE 28498804
★☆☆☆☆
Found in Text Mining only
Arteriosclerosis Arteriosclerosis BEFREE 29333662
★☆☆☆☆
Found in Text Mining only
Arthritis Psoriatic Psoriatic arthritis Pubtator 22402441 Associate
★☆☆☆☆
Found in Text Mining only
Atherosclerosis Atherosclerosis BEFREE 29333662
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Breast neoplasm Pubtator 19136201 Stimulate
★☆☆☆☆
Found in Text Mining only
Carcinoma Hepatocellular Hepatocellular carcinoma Pubtator 33546025 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma of lung Lung carcinoma BEFREE 23451142, 28498804
★☆☆☆☆
Found in Text Mining only