IAPP (islet amyloid polypeptide)

Gene

• Entrez ID: 3375
• Gene name: Islet amyloid polypeptide
• Gene symbol: IAPP
• Synonyms (NCBI Gene): DAP, IAP
• Chromosome: 12
• Chromosome location: 12p12.1
• Summary: This gene encodes a member of the calcitonin family of peptide hormones. This hormone is released from pancreatic beta cells following food intake to regulate blood glucose levels and act as a satiation signal. Human patients with type 1 and advanced type

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018914	hsa-miR-335-5p	Microarray	18185580
MIRT030101	hsa-miR-26b-5p	Microarray	19088304
MIRT440479	hsa-miR-376a-3p	HITS-CLIP	24374217
MIRT440477	hsa-miR-432-5p	HITS-CLIP	24374217
MIRT440476	hsa-miR-1185-2-3p	HITS-CLIP	24374217
MIRT440475	hsa-miR-1185-1-3p	HITS-CLIP	24374217
MIRT440479	hsa-miR-376a-3p	HITS-CLIP	24374217
MIRT440477	hsa-miR-432-5p	HITS-CLIP	24374217
MIRT440476	hsa-miR-1185-2-3p	HITS-CLIP	24374217
MIRT440475	hsa-miR-1185-1-3p	HITS-CLIP	24374217
MIRT1057988	hsa-miR-106a	CLIP-seq
MIRT1057989	hsa-miR-106b	CLIP-seq
MIRT1057990	hsa-miR-1200	CLIP-seq
MIRT1057991	hsa-miR-1234	CLIP-seq
MIRT1057992	hsa-miR-124	CLIP-seq
MIRT1057993	hsa-miR-1281	CLIP-seq
MIRT1057994	hsa-miR-1343	CLIP-seq
MIRT1057995	hsa-miR-150	CLIP-seq
MIRT1057996	hsa-miR-17	CLIP-seq
MIRT1057997	hsa-miR-197	CLIP-seq
MIRT1057998	hsa-miR-1976	CLIP-seq
MIRT1057999	hsa-miR-20a	CLIP-seq
MIRT1058000	hsa-miR-20b	CLIP-seq
MIRT1058001	hsa-miR-302a	CLIP-seq
MIRT1058002	hsa-miR-302b	CLIP-seq
MIRT1058003	hsa-miR-302c	CLIP-seq
MIRT1058004	hsa-miR-302d	CLIP-seq
MIRT1058005	hsa-miR-302e	CLIP-seq
MIRT1058006	hsa-miR-31	CLIP-seq
MIRT1058007	hsa-miR-3149	CLIP-seq
MIRT1058008	hsa-miR-3155	CLIP-seq
MIRT1058009	hsa-miR-3155b	CLIP-seq
MIRT1058010	hsa-miR-3663-5p	CLIP-seq
MIRT1058011	hsa-miR-3714	CLIP-seq
MIRT1058012	hsa-miR-372	CLIP-seq
MIRT1058013	hsa-miR-373	CLIP-seq
MIRT1058014	hsa-miR-3910	CLIP-seq
MIRT1058015	hsa-miR-411	CLIP-seq
MIRT1058016	hsa-miR-4279	CLIP-seq
MIRT1058017	hsa-miR-4324	CLIP-seq
MIRT1058018	hsa-miR-4438	CLIP-seq
MIRT1058019	hsa-miR-4503	CLIP-seq
MIRT1058020	hsa-miR-4707-5p	CLIP-seq
MIRT1058021	hsa-miR-4716-5p	CLIP-seq
MIRT1058022	hsa-miR-4722-3p	CLIP-seq
MIRT1058023	hsa-miR-4731-5p	CLIP-seq
MIRT1058024	hsa-miR-4735-5p	CLIP-seq
MIRT1058025	hsa-miR-4742-5p	CLIP-seq
MIRT1058026	hsa-miR-4763-5p	CLIP-seq
MIRT1058027	hsa-miR-4775	CLIP-seq
MIRT1058028	hsa-miR-4781-3p	CLIP-seq
MIRT1058029	hsa-miR-484	CLIP-seq
MIRT1058030	hsa-miR-506	CLIP-seq
MIRT1058031	hsa-miR-5095	CLIP-seq
MIRT1058032	hsa-miR-5096	CLIP-seq
MIRT1058033	hsa-miR-512-3p	CLIP-seq
MIRT1058034	hsa-miR-519d	CLIP-seq
MIRT1058035	hsa-miR-520a-3p	CLIP-seq
MIRT1058036	hsa-miR-520b	CLIP-seq
MIRT1058037	hsa-miR-520c-3p	CLIP-seq
MIRT1058038	hsa-miR-520d-3p	CLIP-seq
MIRT1058039	hsa-miR-520e	CLIP-seq
MIRT1058040	hsa-miR-520g	CLIP-seq
MIRT1058041	hsa-miR-520h	CLIP-seq
MIRT1058042	hsa-miR-544b	CLIP-seq
MIRT1058043	hsa-miR-590-3p	CLIP-seq
MIRT1058044	hsa-miR-629	CLIP-seq
MIRT1058045	hsa-miR-93	CLIP-seq
MIRT1057988	hsa-miR-106a	CLIP-seq
MIRT1057989	hsa-miR-106b	CLIP-seq
MIRT1057991	hsa-miR-1234	CLIP-seq
MIRT1057995	hsa-miR-150	CLIP-seq
MIRT1057996	hsa-miR-17	CLIP-seq
MIRT1057997	hsa-miR-197	CLIP-seq
MIRT1057999	hsa-miR-20a	CLIP-seq
MIRT1058000	hsa-miR-20b	CLIP-seq
MIRT1058001	hsa-miR-302a	CLIP-seq
MIRT1058002	hsa-miR-302b	CLIP-seq
MIRT1058003	hsa-miR-302c	CLIP-seq
MIRT1058004	hsa-miR-302d	CLIP-seq
MIRT1058005	hsa-miR-302e	CLIP-seq
MIRT1058007	hsa-miR-3149	CLIP-seq
MIRT1058008	hsa-miR-3155	CLIP-seq
MIRT1058009	hsa-miR-3155b	CLIP-seq
MIRT1058010	hsa-miR-3663-5p	CLIP-seq
MIRT1058012	hsa-miR-372	CLIP-seq
MIRT1058013	hsa-miR-373	CLIP-seq
MIRT1058015	hsa-miR-411	CLIP-seq
MIRT1058018	hsa-miR-4438	CLIP-seq
MIRT1058020	hsa-miR-4707-5p	CLIP-seq
MIRT1058021	hsa-miR-4716-5p	CLIP-seq
MIRT1058023	hsa-miR-4731-5p	CLIP-seq
MIRT1058026	hsa-miR-4763-5p	CLIP-seq
MIRT1058028	hsa-miR-4781-3p	CLIP-seq
MIRT1058029	hsa-miR-484	CLIP-seq
MIRT2013336	hsa-miR-495	CLIP-seq
MIRT1058031	hsa-miR-5095	CLIP-seq
MIRT1058032	hsa-miR-5096	CLIP-seq
MIRT1058033	hsa-miR-512-3p	CLIP-seq
MIRT1058034	hsa-miR-519d	CLIP-seq
MIRT1058035	hsa-miR-520a-3p	CLIP-seq
MIRT1058036	hsa-miR-520b	CLIP-seq
MIRT1058037	hsa-miR-520c-3p	CLIP-seq
MIRT1058038	hsa-miR-520d-3p	CLIP-seq
MIRT1058039	hsa-miR-520e	CLIP-seq
MIRT1058040	hsa-miR-520g	CLIP-seq
MIRT1058041	hsa-miR-520h	CLIP-seq
MIRT1058045	hsa-miR-93	CLIP-seq
MIRT1057990	hsa-miR-1200	CLIP-seq
MIRT2245556	hsa-miR-1283	CLIP-seq
MIRT1057997	hsa-miR-197	CLIP-seq
MIRT1057998	hsa-miR-1976	CLIP-seq
MIRT2245557	hsa-miR-3115	CLIP-seq
MIRT1058008	hsa-miR-3155	CLIP-seq
MIRT1058009	hsa-miR-3155b	CLIP-seq
MIRT1058010	hsa-miR-3663-5p	CLIP-seq
MIRT1058016	hsa-miR-4279	CLIP-seq
MIRT1058017	hsa-miR-4324	CLIP-seq
MIRT1058018	hsa-miR-4438	CLIP-seq
MIRT1058021	hsa-miR-4716-5p	CLIP-seq
MIRT1058022	hsa-miR-4722-3p	CLIP-seq
MIRT1058026	hsa-miR-4763-5p	CLIP-seq
MIRT1058028	hsa-miR-4781-3p	CLIP-seq
MIRT2245558	hsa-miR-4795-3p	CLIP-seq
MIRT1058029	hsa-miR-484	CLIP-seq
MIRT1058031	hsa-miR-5095	CLIP-seq
MIRT1058032	hsa-miR-5096	CLIP-seq
MIRT1058042	hsa-miR-544b	CLIP-seq
MIRT1058019	hsa-miR-4503	CLIP-seq
MIRT2548808	hsa-miR-122	CLIP-seq
MIRT1057993	hsa-miR-1281	CLIP-seq
MIRT2548809	hsa-miR-1307	CLIP-seq
MIRT1057994	hsa-miR-1343	CLIP-seq
MIRT1057998	hsa-miR-1976	CLIP-seq
MIRT2548810	hsa-miR-3135b	CLIP-seq
MIRT2548811	hsa-miR-3652	CLIP-seq
MIRT1058016	hsa-miR-4279	CLIP-seq
MIRT2548812	hsa-miR-4284	CLIP-seq
MIRT2548813	hsa-miR-4430	CLIP-seq
MIRT1058019	hsa-miR-4503	CLIP-seq
MIRT2548814	hsa-miR-4638-5p	CLIP-seq
MIRT2548815	hsa-miR-4715-3p	CLIP-seq
MIRT1058022	hsa-miR-4722-3p	CLIP-seq
MIRT2548816	hsa-miR-4772-3p	CLIP-seq
MIRT1058044	hsa-miR-629	CLIP-seq
MIRT2548808	hsa-miR-122	CLIP-seq
MIRT1057993	hsa-miR-1281	CLIP-seq
MIRT2548809	hsa-miR-1307	CLIP-seq
MIRT1057994	hsa-miR-1343	CLIP-seq
MIRT1057998	hsa-miR-1976	CLIP-seq
MIRT2548810	hsa-miR-3135b	CLIP-seq
MIRT2548811	hsa-miR-3652	CLIP-seq
MIRT1058016	hsa-miR-4279	CLIP-seq
MIRT2548812	hsa-miR-4284	CLIP-seq
MIRT2548813	hsa-miR-4430	CLIP-seq
MIRT1058019	hsa-miR-4503	CLIP-seq
MIRT2548814	hsa-miR-4638-5p	CLIP-seq
MIRT2548815	hsa-miR-4715-3p	CLIP-seq
MIRT1058022	hsa-miR-4722-3p	CLIP-seq
MIRT2548816	hsa-miR-4772-3p	CLIP-seq
MIRT1058044	hsa-miR-629	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
GATA4	Activation	17290010

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001540	Function	Amyloid-beta binding	TAS	22500019
GO:0005102	Function	Signaling receptor binding	IPI	22500019
GO:0005102	Function	Signaling receptor binding	TAS	2608057, 10342886
GO:0005179	Function	Hormone activity	IEA
GO:0005179	Function	Hormone activity	ISS
GO:0005515	Function	Protein binding	IPI	17051221, 22500019, 26840340
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	17374526
GO:0005615	Component	Extracellular space	IEA
GO:0006915	Process	Apoptotic process	TAS	8152488
GO:0007165	Process	Signal transduction	TAS	10342886
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	17110384, 35324283
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IGI	22500019
GO:0007267	Process	Cell-cell signaling	TAS	2608057
GO:0008285	Process	Negative regulation of cell population proliferation	IDA	22944668
GO:0008289	Function	Lipid binding	EXP	32077246
GO:0010628	Process	Positive regulation of gene expression	IGI	22500019
GO:0016234	Component	Inclusion body	IDA	22944668
GO:0019233	Process	Sensory perception of pain	IEA
GO:0030316	Process	Osteoclast differentiation	IEA
GO:0031333	Process	Negative regulation of protein-containing complex assembly	TAS	22500019
GO:0031648	Process	Protein destabilization	IDA	22944668
GO:0042755	Process	Eating behavior	IEA
GO:0042802	Function	Identical protein binding	IDA	22944668
GO:0042802	Function	Identical protein binding	IPI	17640888, 18408164, 21130765, 24042052, 24561193, 26840340, 32541895
GO:0043025	Component	Neuronal cell body	IEA
GO:0043065	Process	Positive regulation of apoptotic process	TAS	22500019
GO:0043410	Process	Positive regulation of MAPK cascade	NAS	22500019
GO:0045453	Process	Bone resorption	IEA
GO:0045671	Process	Negative regulation of osteoclast differentiation	IEA
GO:0045779	Process	Negative regulation of bone resorption	IEA
GO:0048018	Function	Receptor ligand activity	IDA	22500019
GO:0048018	Function	Receptor ligand activity	IEA
GO:0048018	Function	Receptor ligand activity	ISS
GO:0050850	Process	Positive regulation of calcium-mediated signaling	IGI	22500019
GO:0051260	Process	Protein homooligomerization	IDA	22944668
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IGI	22500019
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IGI	22500019
GO:0097646	Process	Calcitonin family receptor signaling pathway	IEA
GO:0097647	Process	Amylin receptor signaling pathway	IDA	35324283
GO:0097647	Process	Amylin receptor signaling pathway	IDA	35324283
GO:0097647	Process	Amylin receptor signaling pathway	IEA
GO:0097647	Process	Amylin receptor signaling pathway	IGI	22500019
GO:0097647	Process	Amylin receptor signaling pathway	ISS
GO:0141163	Process	Positive regulation of cAMP/PKA signal transduction	IGI	22500019
GO:0150059	Process	Amylin receptor 1 signaling pathway	IDA	35324283
GO:0150059	Process	Amylin receptor 1 signaling pathway	IDA	35324283
GO:0150060	Process	Amylin receptor 2 signaling pathway	IDA	35324283
GO:0150060	Process	Amylin receptor 2 signaling pathway	IDA	35324283
GO:0150061	Process	Amylin receptor 3 signaling pathway	IDA	35324283
GO:0150061	Process	Amylin receptor 3 signaling pathway	IDA	35324283
GO:1905907	Process	Negative regulation of amyloid fibril formation	TAS	22500019
GO:1990000	Process	Amyloid fibril formation	IDA	22944668

Other IDs

• MIM: 147940
• HGNC: 5329
• e!Ensembl: ENSG00000121351

Protein

• UniProt ID: P10997
• Protein name: Islet amyloid polypeptide (IAPP) (Amylin) (Diabetes-associated peptide) (DAP) (Insulinoma amyloid peptide)
• Protein function: Amylin/IAPP is a glucoregulatory peptide hormone that plays an important role in the regulation of energy homeostasis (PubMed:2690069). Selectively inhibits insulin-stimulated glucose utilization and glycogen deposition in muscle, while not affe
• PDB: 1KUW, 2G48, 2KB8, 2L86, 3DG1, 3FPO, 3FR1, 3FTH, 3FTK, 3FTL, 3FTR, 3G7V, 3G7W, 3HGZ, 5K5G, 5KNZ, 5KO0, 5MGQ, 6UCJ, 6UCK, 6VW2, 6Y1A, 6ZRF, 6ZRQ, 6ZRR, 7BG0, 7M61, 7M62, 7M64, 7M65, 7YKW, 7YL0, 7YL3, 7YL7, 8AWT, 8AZ0, 8AZ1, 8AZ2, 8AZ3, 8AZ4, 8AZ5, 8AZ6, 8AZ7, 8F0J, 8F0K, 8F2A, 8F2B, 8R4I, 8YG2, 9GZ6, 9GZP
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00214	Calc_CGRP_IAPP	25 → 75	Calcitonin / CGRP / IAPP family	Family

• Sequence:

  MGILKLQVFLIVLSVALNHLKATPIESHQVEKRKCNTATCATQRLANFLVHSSNNFGAIL
  SSTNVGSNTYGKRNAVEVLKREPLNYLPL

• Sequence length: 89

Pathways

KEGG:

Neuroactive ligand-receptor interaction
Hormone signaling
Maturity onset diabetes of the young

Reactome:

G alpha (s) signalling events
Calcitonin-like ligand receptors
ADORA2B mediated anti-inflammatory cytokines production
Amyloid fiber formation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
DIABETES MELLITUS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, INSULIN-DEPENDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, TYPE 2	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRIC ULCER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
AA amyloidosis	AA amyloidosis	BEFREE	21571086		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	26944210		★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	28426339		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	20299817, 28739611		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	29593496		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	26944210		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	14752113, 22500019, 24898659, 28684415, 31947546, 36835187	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	31507407		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	11327784, 11474116, 12367525, 15878744, 21352095, 23337872, 25387341, 26658464, 28108533, 28550295, 28649025, 28684415, 28694141, 28754022, 28985759, 29086671, 29282295, 29337308, 29372531, 29664151, 30106299, 30299960, 30803034, 31015938, 31739987, 7868080, 7929617, 8529518, 8690157, 9833947		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	Pubtator	15878744, 17563070, 25531836	Associate	★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	LHGDN	18497871		★☆☆☆☆ Found in Text Mining only
AMYLOIDOSIS, HEREDITARY, TRANSTHYRETIN-RELATED	Amyloidosis	BEFREE	29593496		★☆☆☆☆ Found in Text Mining only
AMYOTROPHIC LATERAL SCLEROSIS 1	Lateral Sclerosis	BEFREE	12153481		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	29378867		★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	BEFREE	18177647		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	20119625, 28139689		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	26895962, 26911465	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	15691381		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	29721043, 9487987		★☆☆☆☆ Found in Text Mining only
Carcinoid Tumor	Carcinoid tumor	Pubtator	8317551	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	12810637		★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	20119625, 28139689		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	12384799, 17229588		★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	28768713		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	31739987		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	25168470		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	25168470		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	26944210		★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	30400387		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	30754998		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	24898659	Inhibit	★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	29067318		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	36835187	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	19302291, 31289894		★☆☆☆☆ Found in Text Mining only
Congenital Disorders of Glycosylation	Congenital disorder of glycosylation	BEFREE	21614585, 23622397		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	9119739		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	22783049		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	27354094, 28582864, 28696548		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	27354094	Associate	★☆☆☆☆ Found in Text Mining only
Dementia Vascular	Vascular dementia	Pubtator	31947546	Associate	★☆☆☆☆ Found in Text Mining only
Dementia, Vascular	Dementia	BEFREE	23794448		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	12086946, 15161755, 1573849, 16804082, 16804197, 18633116, 19002432, 19794060, 1999269, 2195544, 23337872, 23745697, 23794448, 25036708, 27865831, 27999871, 28275047, 28368485, 28485843, 28503657, 28739611, 28912603, 29059473, 29066284, 29615609, 29664151, 30082607, 30230179, 30466917, 30919775, 31086953, 7929617, 8277951, 9588445		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	11395927, 15878744, 16467158, 20421596, 25903685, 26895962, 26911465, 28614667, 31922743, 32929282, 36549505	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	11508277, 12086946, 15161755, 1573849, 16804082, 16804197, 18346114, 18633116, 19002432, 19794060, 1999269, 2195544, 23337872, 23745697, 23794448, 25036708, 2670595, 2690958, 27865831, 27999871, 28275047, 28368485, 28485843, 28503657, 28582864, 28739611, 28912603, 29059473, 29066284, 29536165, 29615609, 29664151, 29729352, 30082607, 30230179, 30466917, 30737030, 30919775, 31086953, 7929617, 8212454, 8277951, 8692984, 9588445		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	LHGDN	17617411		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	33832546	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	10931181, 11445568, 11790844, 15878744, 16467158, 17563070, 18556473, 18694973, 19015532, 19475663, 20421596, 20698575, 21195086, 22174920, 22206987, 22500019, 22734583, 23086037, 23133593, 23256729, 23388629, 24218609, 24654599, 24703313, 25531836, 2639135, 26453203, 26453205, 2651160, 2690069, 27607147, 27854243, 28661686, 28684415, 28851981, 29526462, 30014749, 30015901, 31705766, 31768548, 31922743, 31947546, 32929282, 3317417, 34044067, 34882862, 35210421, 36835187, 36967805, 38367541, 39174611, 9560308	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	17475933, 2258001, 2690958, 27111653, 28269785, 28368485, 28433710, 28877460, 29378867, 30086232, 30230179, 30282360, 7929617, 8212454, 8516954		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	10084586, 11318791, 11508277, 11791616, 12079621, 12367525, 12431815, 12588049, 12679865, 12706321, 12786686, 1282806, 12941770, 1359959, 1371737, 1453875, 14722650, 15161755, 15342243, 1541234, 1563587, 1573849, 15878744, 16399206, 1676684, 16804082, 16804197, 17213278, 17475933, 17617411, 17911343, 19015532, 19151199, 19403868, 19475663, 19794060, 1999269, 20069542, 20835230, 20980462, 21148563, 21219896, 21352095, 21571086, 2192709, 22275486, 2258001, 22928566, 23229548, 23256729, 23349537, 23745697, 23776430, 23794448, 24879150, 24928165, 25036706, 25036708, 25342134, 25387341, 25409149, 25491100, 26191799, 26242245, 26453205, 26483547, 26503000, 2666169, 26786104, 26840340, 2690069, 26900721, 2690958, 26960140, 27354094, 27624579, 27743934, 27804051, 27865831, 27997176, 27999871, 28004495, 28044060, 28054630, 28054763, 28071890, 28078343, 28220836, 28223444, 28231451, 28269785, 28300592, 28465284, 28550295, 28655134, 28661686, 28665109, 28672144, 28684415, 28692245, 28702523, 28754022, 28765400, 28768713, 28786287, 28798389, 28808140, 28811318, 28829144, 28973954, 28980863, 29023509, 29035554, 29038815, 29066284, 29072444, 29115353, 29145032, 29148426, 29169962, 29251925, 29337308, 29352842, 29360346, 29366673, 29372531, 29378116, 29378867, 29406755, 29432676, 29501606, 29501724, 29505875, 29507232, 29518374, 29523142, 29526462, 29577153, 29580826, 29626442, 29627323, 29702073, 29705815, 29936141, 30002264, 30014749, 30086232, 30230179, 30245473, 30282360, 30287490, 30327182, 30350837, 30369028, 30375231, 30395705, 30407835, 30419808, 30463298, 30468944, 30569165, 30803034, 30814273, 30852627, 30917341, 30974231, 30975901, 31015938, 31062393, 31155148, 31195047, 31213603, 31231935, 31295403, 31333136, 31376172, 31455083, 31456396, 31493679, 31504890, 31601900, 31620893, 31642657, 31705766, 31739987, 31768548, 31777253, 7868080, 7929617, 8200302, 8212454, 8323756, 8477877, 8495745, 8529518, 8593932, 8622964, 8690157, 8692984, 8772735, 8885173, 9251946, 9322799, 9623635		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	LHGDN	12221327, 12706318, 14578294, 15710403, 18408164, 18483616, 18497871, 18815541		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	CTD_human_DG	16123366, 23793354		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes, Autoimmune	Autoimmune Diabetes	BEFREE	28983871		★☆☆☆☆ Found in Text Mining only
Diabetic Angiopathies	Diabetic cardiomyopathy	BEFREE	31739987		★☆☆☆☆ Found in Text Mining only
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	BEFREE	22275486, 29066284		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	LHGDN	17495860		★☆☆☆☆ Found in Text Mining only
Donohue Syndrome	Leprechaunism syndrome	BEFREE	29226618		★☆☆☆☆ Found in Text Mining only
Dystrophia myotonica 2	Myotonic dystrophy	BEFREE	16950544, 27743934		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	25376458		★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	11081774		★☆☆☆☆ Found in Text Mining only
Extrahepatic Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	20720444		★☆☆☆☆ Found in Text Mining only
Fragile X Syndrome	Fragile X Syndrome	BEFREE	30954995		★☆☆☆☆ Found in Text Mining only
Gastric ulcer	Gastric ulcer	CTD_human_DG	9286623		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gingival Diseases	Gingival diseases	Pubtator	33934404	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	12027563		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	23538445, 30385739		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	23538445, 30385739		★☆☆☆☆ Found in Text Mining only
Glucagonoma	Glucagonoma	BEFREE	1850107		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	29518374		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	29526462	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	16304383, 21960246, 24487414, 29067538		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	15967379, 21571086		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	11272181, 1453875, 15161755, 1573849, 19002432, 19201608, 25491100, 27111653, 27624579, 27999871, 28118069, 28223444, 28337562, 31155148, 8622964, 9322799		★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	12086946, 29523142		★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type III	Hyperlipoproteinemia	BEFREE	12637985		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	11081774, 17213278, 7649582		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	LHGDN	17213278		★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	10866048, 2690958		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	23492187		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	24898659, 26503000, 29067318		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	22783049		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	33832546, 39174611, 9560308	Associate	★☆☆☆☆ Found in Text Mining only
insulinoma	Insulinoma	BEFREE	10037255, 1362976, 14613923, 1850107, 2192709, 26191799, 2651160, 29627323, 3053705, 31004596, 8050128, 8317551, 8323756, 9166666		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	28433710		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	28433710	Inhibit	★☆☆☆☆ Found in Text Mining only
Intervertebral disc disorder	Intervertebral Disc Disorder	BEFREE	28433710		★☆☆☆☆ Found in Text Mining only
LEPTIN RECEPTOR DEFICIENCY	LEPTIN RECEPTOR DEFICIENCY	BEFREE	30133304		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	19298593, 24487414		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	15380346, 27869161		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	24175757, 28036295		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	29538440		★☆☆☆☆ Found in Text Mining only
Lung Diseases, Obstructive	Lung Diseases	BEFREE	30754998		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	24487414, 25409149		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Syndrome, X-Linked, 2	Lymphoproliferative Disorder	BEFREE	29743550		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	BEFREE	15691381		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	29721043		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	12384799, 17229588		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	20720442, 20720444, 20720447, 22213040, 8277951		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	20698994, 25071009, 28981528		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	20119625, 28139689		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15068902, 15611788, 17573556, 18068526, 18336193, 18931663, 18931692, 19298593, 20299817, 22342104, 24704827, 27424523, 28215531, 28771230, 29371939, 29569123, 30385275, 31176273, 31645676		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	25168470		★☆☆☆☆ Found in Text Mining only
Maturity onset diabetes mellitus in young	Mason type diabetes	BEFREE	1999269		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	14735472, 17168540, 20576118, 22853455		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	28337955	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	23794448, 28300592, 29115353, 29337308, 8516954		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	20807286	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	20807286		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	28233915, 28485843		★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	24614496		★☆☆☆☆ Found in Text Mining only
Multiple Endocrine Neoplasia Type 1	Multiple Endocrine Neoplasia	BEFREE	1362976		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	1906605, 26036313		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	15380346		★☆☆☆☆ Found in Text Mining only
Myelofibrosis	Myelofibrosis	BEFREE	29749399		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	28881589		★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	20421596	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	18953427, 20576118		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10037255, 12591734, 1362976, 16327988, 18336193, 1850107, 20299817, 20698994, 21118954, 24175757, 25409149, 27129149, 28665401, 29465464, 31173249, 7597142, 8277951, 8317551, 9256286		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	26575016		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	33832546	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	28363773, 28635330, 31062393		★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	8050128		★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	31744383		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	12086946, 12431815, 18252898, 22275486, 23337872, 25146704, 26398307, 26503000, 2690958, 29191090, 29203236, 29729352, 29936463, 30974231, 31333136, 7649582, 7929617, 8516954, 8529518, 9251946		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	26911465	Associate	★☆☆☆☆ Found in Text Mining only
Osteitis Deformans	Paget disease	BEFREE	1722443		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	37361541	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	27129149		★☆☆☆☆ Found in Text Mining only
PACHYONYCHIA CONGENITA 3	Pachyonychia Congenita	BEFREE	30400387		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	20720442, 20720444, 20720447, 22213040, 8277951		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma, familial	Pancreatic carcinoma	BEFREE	18497537		★☆☆☆☆ Found in Text Mining only
Pancreatic Diseases	Pancreatic Diseases	BEFREE	22275486, 23794448		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	31731384		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	2690069	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	16467158, 3181427, 31922743	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	21571086, 26453205, 28220836, 29366673		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	34882862	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	30343311, 30672430		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	27354094, 28582864, 28696548		★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	BEFREE	29749399		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	20698994, 25071009, 28981528		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	36774376	Associate	★☆☆☆☆ Found in Text Mining only
Reactive systemic amyloidosis	Reactive Systemic Amyloidosis	BEFREE	21571086		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	9119739		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	24704827		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	29352842		★☆☆☆☆ Found in Text Mining only
Senile cardiac amyloidosis	Senile Cardiac Amyloidosis	BEFREE	29593496		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	29990318		★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophy	Spinal Muscular Atrophy	BEFREE	8552191		★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	31306122		★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid Diseases	BEFREE	28589091		★☆☆☆☆ Found in Text Mining only
Thyroid Nodule	Thyroid Nodule	BEFREE	29546655, 29569123		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	22783049		★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	18853322		★☆☆☆☆ Found in Text Mining only
Ventricular Fibrillation	Ventricular fibrillation	Pubtator	19475663	Associate	★☆☆☆☆ Found in Text Mining only