Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	3363
Gene name	5-hydroxytryptamine receptor 7
Gene symbol	HTR7
Synonyms (NCBI Gene)	5-HT7
Chromosome	10
Chromosome location	10q23.31
Summary	The neurotransmitter, serotonin, is thought to play a role in various cognitive and behavioral functions. The serotonin receptor encoded by this gene belongs to the superfamily of G protein-coupled receptors and the gene is a candidate locus for involveme

124

Show/Hide all (124)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016917	hsa-miR-335-5p	Microarray	18185580
MIRT528508	hsa-miR-5580-3p	PAR-CLIP	21572407
MIRT528507	hsa-miR-1246	PAR-CLIP	21572407
MIRT528506	hsa-miR-490-5p	PAR-CLIP	21572407
MIRT528505	hsa-miR-4301	PAR-CLIP	21572407
MIRT540122	hsa-miR-532-3p	PAR-CLIP	21572407
MIRT528504	hsa-miR-3167	PAR-CLIP	21572407
MIRT528503	hsa-miR-876-5p	PAR-CLIP	21572407
MIRT528501	hsa-miR-1290	PAR-CLIP	21572407
MIRT528502	hsa-miR-3156-3p	PAR-CLIP	21572407
MIRT528500	hsa-miR-5011-3p	PAR-CLIP	21572407
MIRT528499	hsa-miR-4666b	PAR-CLIP	21572407
MIRT528498	hsa-miR-4520-3p	PAR-CLIP	21572407
MIRT528497	hsa-miR-4520-2-3p	PAR-CLIP	21572407
MIRT528496	hsa-miR-4529-3p	PAR-CLIP	21572407
MIRT528495	hsa-miR-7850-5p	PAR-CLIP	21572407
MIRT528508	hsa-miR-5580-3p	PAR-CLIP	22012620
MIRT528507	hsa-miR-1246	PAR-CLIP	22012620
MIRT528506	hsa-miR-490-5p	PAR-CLIP	22012620
MIRT528505	hsa-miR-4301	PAR-CLIP	22012620
MIRT528504	hsa-miR-3167	PAR-CLIP	22012620
MIRT528503	hsa-miR-876-5p	PAR-CLIP	22012620
MIRT528501	hsa-miR-1290	PAR-CLIP	22012620
MIRT528502	hsa-miR-3156-3p	PAR-CLIP	22012620
MIRT528500	hsa-miR-5011-3p	PAR-CLIP	22012620
MIRT528499	hsa-miR-4666b	PAR-CLIP	22012620
MIRT528498	hsa-miR-4520-3p	PAR-CLIP	22012620
MIRT528497	hsa-miR-4520-2-3p	PAR-CLIP	22012620
MIRT528496	hsa-miR-4529-3p	PAR-CLIP	22012620
MIRT528495	hsa-miR-7850-5p	PAR-CLIP	22012620
MIRT528508	hsa-miR-5580-3p	PAR-CLIP	21572407
MIRT528507	hsa-miR-1246	PAR-CLIP	21572407
MIRT528506	hsa-miR-490-5p	PAR-CLIP	21572407
MIRT528505	hsa-miR-4301	PAR-CLIP	21572407
MIRT540122	hsa-miR-532-3p	PAR-CLIP	21572407
MIRT528504	hsa-miR-3167	PAR-CLIP	21572407
MIRT528503	hsa-miR-876-5p	PAR-CLIP	21572407
MIRT528501	hsa-miR-1290	PAR-CLIP	21572407
MIRT528502	hsa-miR-3156-3p	PAR-CLIP	21572407
MIRT528500	hsa-miR-5011-3p	PAR-CLIP	21572407
MIRT528499	hsa-miR-4666b	PAR-CLIP	21572407
MIRT528498	hsa-miR-4520-3p	PAR-CLIP	21572407
MIRT528497	hsa-miR-4520-2-3p	PAR-CLIP	21572407
MIRT528496	hsa-miR-4529-3p	PAR-CLIP	21572407
MIRT528495	hsa-miR-7850-5p	PAR-CLIP	21572407
MIRT528508	hsa-miR-5580-3p	PAR-CLIP	22012620
MIRT528507	hsa-miR-1246	PAR-CLIP	22012620
MIRT528506	hsa-miR-490-5p	PAR-CLIP	22012620
MIRT528505	hsa-miR-4301	PAR-CLIP	22012620
MIRT528504	hsa-miR-3167	PAR-CLIP	22012620
MIRT528503	hsa-miR-876-5p	PAR-CLIP	22012620
MIRT528501	hsa-miR-1290	PAR-CLIP	22012620
MIRT528502	hsa-miR-3156-3p	PAR-CLIP	22012620
MIRT528500	hsa-miR-5011-3p	PAR-CLIP	22012620
MIRT528499	hsa-miR-4666b	PAR-CLIP	22012620
MIRT528498	hsa-miR-4520-3p	PAR-CLIP	22012620
MIRT528497	hsa-miR-4520-2-3p	PAR-CLIP	22012620
MIRT528496	hsa-miR-4529-3p	PAR-CLIP	22012620
MIRT528495	hsa-miR-7850-5p	PAR-CLIP	22012620
MIRT1057332	hsa-miR-371-3p	CLIP-seq
MIRT1057333	hsa-miR-371b-3p	CLIP-seq
MIRT1057334	hsa-miR-376c	CLIP-seq
MIRT1057335	hsa-miR-515-3p	CLIP-seq
MIRT1057336	hsa-miR-519e	CLIP-seq
MIRT1057337	hsa-miR-1301	CLIP-seq
MIRT1057338	hsa-miR-29a	CLIP-seq
MIRT1057339	hsa-miR-29b	CLIP-seq
MIRT1057340	hsa-miR-29c	CLIP-seq
MIRT1057341	hsa-miR-3065-5p	CLIP-seq
MIRT1057342	hsa-miR-324-5p	CLIP-seq
MIRT1057343	hsa-miR-330-3p	CLIP-seq
MIRT1057344	hsa-miR-3910	CLIP-seq
MIRT1057345	hsa-miR-4520a-3p	CLIP-seq
MIRT1057346	hsa-miR-4520b-3p	CLIP-seq
MIRT1057347	hsa-miR-4660	CLIP-seq
MIRT1057348	hsa-miR-5047	CLIP-seq
MIRT1057349	hsa-miR-518a-5p	CLIP-seq
MIRT1057350	hsa-miR-527	CLIP-seq
MIRT1057338	hsa-miR-29a	CLIP-seq
MIRT1057339	hsa-miR-29b	CLIP-seq
MIRT1057340	hsa-miR-29c	CLIP-seq
MIRT1057343	hsa-miR-330-3p	CLIP-seq
MIRT1057345	hsa-miR-4520a-3p	CLIP-seq
MIRT1057346	hsa-miR-4520b-3p	CLIP-seq
MIRT1057349	hsa-miR-518a-5p	CLIP-seq
MIRT1057350	hsa-miR-527	CLIP-seq
MIRT1057338	hsa-miR-29a	CLIP-seq
MIRT1057339	hsa-miR-29b	CLIP-seq
MIRT1057340	hsa-miR-29c	CLIP-seq
MIRT1057343	hsa-miR-330-3p	CLIP-seq
MIRT1057345	hsa-miR-4520a-3p	CLIP-seq
MIRT1057346	hsa-miR-4520b-3p	CLIP-seq
MIRT1057349	hsa-miR-518a-5p	CLIP-seq
MIRT1057350	hsa-miR-527	CLIP-seq
MIRT1057338	hsa-miR-29a	CLIP-seq
MIRT1057339	hsa-miR-29b	CLIP-seq
MIRT1057340	hsa-miR-29c	CLIP-seq
MIRT1057343	hsa-miR-330-3p	CLIP-seq
MIRT1057345	hsa-miR-4520a-3p	CLIP-seq
MIRT1057346	hsa-miR-4520b-3p	CLIP-seq
MIRT1057349	hsa-miR-518a-5p	CLIP-seq
MIRT1057350	hsa-miR-527	CLIP-seq
MIRT1057338	hsa-miR-29a	CLIP-seq
MIRT1057339	hsa-miR-29b	CLIP-seq
MIRT1057340	hsa-miR-29c	CLIP-seq
MIRT2245384	hsa-miR-3148	CLIP-seq
MIRT1057343	hsa-miR-330-3p	CLIP-seq
MIRT1057345	hsa-miR-4520a-3p	CLIP-seq
MIRT1057346	hsa-miR-4520b-3p	CLIP-seq
MIRT1057349	hsa-miR-518a-5p	CLIP-seq
MIRT1057350	hsa-miR-527	CLIP-seq
MIRT1057338	hsa-miR-29a	CLIP-seq
MIRT1057339	hsa-miR-29b	CLIP-seq
MIRT1057340	hsa-miR-29c	CLIP-seq
MIRT1057343	hsa-miR-330-3p	CLIP-seq
MIRT1057345	hsa-miR-4520a-3p	CLIP-seq
MIRT1057346	hsa-miR-4520b-3p	CLIP-seq
MIRT1057349	hsa-miR-518a-5p	CLIP-seq
MIRT1057350	hsa-miR-527	CLIP-seq
MIRT2451474	hsa-miR-3662	CLIP-seq
MIRT2451475	hsa-miR-3674	CLIP-seq
MIRT2451476	hsa-miR-4312	CLIP-seq
MIRT2451477	hsa-miR-4693-3p	CLIP-seq
MIRT2451478	hsa-miR-4712-3p	CLIP-seq

Show/Hide all (33)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004993	Function	G protein-coupled serotonin receptor activity	IBA
GO:0004993	Function	G protein-coupled serotonin receptor activity	IDA	8226867, 35714614
GO:0004993	Function	G protein-coupled serotonin receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	19486527, 30021884
GO:0005654	Component	Nucleoplasm	IDA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	22448645
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005929	Component	Cilium	IDA
GO:0006939	Process	Smooth muscle contraction	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007187	Process	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	IBA
GO:0007187	Process	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	TAS	8226867
GO:0007192	Process	Adenylate cyclase-activating serotonin receptor signaling pathway	IDA	17110384
GO:0007192	Process	Adenylate cyclase-activating serotonin receptor signaling pathway	IDA	8226867, 35714614
GO:0007268	Process	Chemical synaptic transmission	IBA
GO:0007268	Process	Chemical synaptic transmission	IEA
GO:0007268	Process	Chemical synaptic transmission	TAS	8226867
GO:0007623	Process	Circadian rhythm	IEA
GO:0007623	Process	Circadian rhythm	TAS	8398139
GO:0008015	Process	Blood circulation	TAS	8226867
GO:0016020	Component	Membrane	IEA
GO:0030425	Component	Dendrite	IBA
GO:0030594	Function	Neurotransmitter receptor activity	IBA
GO:0032588	Component	Trans-Golgi network membrane	TAS
GO:0042310	Process	Vasoconstriction	IEA
GO:0045202	Component	Synapse	IEA
GO:0098664	Process	G protein-coupled serotonin receptor signaling pathway	IEA
GO:0099589	Function	Serotonin receptor activity	IDA	35714614

MIM	HGNC	e!Ensembl
182137	5302	ENSG00000148680

P34969

Protein name

5-hydroxytryptamine receptor 7 (5-HT-7) (5-HT7) (5-HT-X) (Serotonin receptor 7)

Protein function

G-protein coupled receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone and a mitogen (PubMed:35714614, PubMed:8226867). Ligand binding causes a conformation change that triggers signali

PDB

7XTC

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	98 → 384	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: [Isoform A]: Predominant isoform in spleen, caudate and hippocampus. {ECO:0000269|PubMed:9084407}.; TISSUE SPECIFICITY: [Isoform B]: Expressed at lower levels. {ECO:0000269|PubMed:9084407}.; TISSUE SPECIFICITY: [Isoform D]: Minor isofo

Sequence

MMDVNSSGRPDLYGHLRSFLLPEVGRGLPDLSPDGGADPVAGSWAPHLLSEVTASPAPTW
DAPPDNASGCGEQINYGRVEKVVIGSILTLITLLTIAGNCLVVISVCFVKKLRQPSNYLI
VSLALADLSVAVAVMPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVISIDR
YLGITRPLTYPVRQNGKCMAKMILSVWLLSASITLPPLFGWAQNVNDDKVCLISQDFGYT
IYSTAVAFYIPMSVMLFMYYQIYKAARKSAAKHKFPGFPRVEPDSVIALNGIVKLQKEVE
ECANLSRLLKHERKNISIFKREQKAATTLGIIVGAFTVCWLPFFLLSTARPFICGTSCSC
IPLWVERTFLWLGYANSLINPFIYAFFNRDLRTTYRSLLQCQYRNINRKLSAAGMHEALK
LAERPERPEFVLRACTRRVLLRPEKRPPVSVWVLQSPDHHNWLADKMLTTVEKKVMIHD

Sequence length

479

Interactions

View interactions

	KEGG		Reactome
	Ras signaling pathway Calcium signaling pathway Neuroactive ligand-receptor interaction Serotonergic synapse		Serotonin receptors G alpha (s) signalling events ADORA2B mediated anti-inflammatory cytokines production

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (13)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANXIETY DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEARNING DISABILITIES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEARNING DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MEMORY DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOPATHY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (66)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adrenocortical carcinoma	Adrenocortical carcinoma	BEFREE	18708508		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Learning Disorders	Learning Disorders	CTD_human_DG	21859099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Age-Related Memory Disorders	Age-Related Memory Disorders	CTD_human_DG	21859099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	15048644, 19649616		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	15048644, 19649616		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anxiety Disorders	Anxiety Disorder	CTD_human_DG	21859099		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anxiety States, Neurotic	Anxiety Disorder	CTD_human_DG	21859099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	27380831		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	10490701		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	9154233		★★★★★ ★☆☆☆☆ Found in Text Mining only
Circadian Rhythm Disorders	Circadian Rhythm Disorders	BEFREE	15896881		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	28043031		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	25072499		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	25072499		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cyclin-dependent kinase-like 5 deficiency	Cyclin-Dependent Kinase-Like 5 Deficiency	BEFREE	30326240		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depression, Neurotic	Mental Depression	CTD_human_DG	21859099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	15032609, 19649616, 28901854		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	PSYGENET_DG	18712364, 19649616, 20097233, 22843252, 23276605		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	CTD_human_DG	21859099		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Syndrome	Mental Depression	CTD_human_DG	21859099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endogenous depression	Mental Depression	CTD_human_DG	21859099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	28043031		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gilles de la Tourette syndrome	Tourette Syndrome	BEFREE	7601444		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	15339860, 29958636		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	15339860, 29958636		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	28821451		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	28758583		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	27380831		★★★★★ ★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	30827505		★★★★★ ★☆☆☆☆ Found in Text Mining only
Learning Disabilities	Learning Disorders	CTD_human_DG	21859099		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Learning Disorders	Learning Disorders	CTD_human_DG	21859099		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Learning Disturbance	Learning Disorders	CTD_human_DG	21859099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	28043031		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 1	Major Affective Disorder	BEFREE	9154233		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 2	Major Affective Disorder	BEFREE	9154233		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 4	Major Affective Disorder	BEFREE	9154233		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 6	Major Affective Disorder	BEFREE	9154233		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 7	Major Affective Disorder	BEFREE	9154233		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 8	Major Affective Disorder	BEFREE	9154233		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 9	Major Affective Disorder	BEFREE	9154233		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melancholia	Melancholia	CTD_human_DG	21859099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Memory Disorders	Memory Disorders	CTD_human_DG	21859099		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	BEFREE	15032609, 19649616, 28901854		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	PSYGENET_DG	18712364, 19649616, 20097233, 22843252, 23276605		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental disorders	Mental Disorders	BEFREE	9707296		★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	Pubtator	22678113	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	28043031		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	PSYGENET_DG	18948124		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myopathy	Myopathy	CTD_human_DG	17600820		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasms	Neoplasms	BEFREE	18708508		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	19649616, 30685503		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	30685503		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodevelopmental Disorders	Neurodevelopmental Disorders	BEFREE	27380831, 28419872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	28758583		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pervasive Development Disorder	Autism spectrum disorder	BEFREE	27380831		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	28758583		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rett Syndrome	Rett Syndrome	BEFREE	28419872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	CTD_human_DG	12165372		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	BEFREE	16192982, 18855532, 19233240, 19649616, 26609891, 28043031, 9154233		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Short Sleeper Syndrome	Short Sleeper Syndromes	CTD_human_DG	21859099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	26074006		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Disorders	Sleep Disorders	CTD_human_DG	21859099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Wake Disorders	Sleep Wake Disorders	CTD_human_DG	21859099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	27796714		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	27022227		★★★★★ ★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	CTD_human_DG	21859099		★★★★★ ★☆☆☆☆ Found in Text Mining only

HTR7 (5-hydroxytryptamine receptor 7)