HTR6 (5-hydroxytryptamine receptor 6)

Gene

• Entrez ID: 3362
• Gene name: 5-hydroxytryptamine receptor 6
• Gene symbol: HTR6
• Synonyms (NCBI Gene): 5-HT6, 5-HT6R
• Chromosome: 1
• Chromosome location: 1p36.13
• Summary: This gene encodes a protein that belongs to the seven-transmembrane G protein-coupled receptor family of proteins. The encoded protein couples with the Gs alpha subunit and stimulates adenylate cyclase to activate the cyclic AMP-dependent signaling pathwa

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT2013104	hsa-miR-1182	CLIP-seq
MIRT2013105	hsa-miR-767-3p	CLIP-seq
MIRT2013104	hsa-miR-1182	CLIP-seq
MIRT2245381	hsa-miR-1266	CLIP-seq
MIRT2245382	hsa-miR-4518	CLIP-seq
MIRT2245383	hsa-miR-510	CLIP-seq
MIRT2013105	hsa-miR-767-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004969	Function	Histamine receptor activity	TAS	8522988
GO:0004993	Function	G protein-coupled serotonin receptor activity	IBA
GO:0004993	Function	G protein-coupled serotonin receptor activity	IDA	35714614, 36989299, 37327704
GO:0004993	Function	G protein-coupled serotonin receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	17189269, 23027611, 24614691, 30853821
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	37327704
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	8522988
GO:0005929	Component	Cilium	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007187	Process	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	IBA
GO:0007187	Process	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	TAS	8522988
GO:0007188	Process	Adenylate cyclase-modulating G protein-coupled receptor signaling pathway	IBA
GO:0007192	Process	Adenylate cyclase-activating serotonin receptor signaling pathway	IDA	17110384
GO:0007192	Process	Adenylate cyclase-activating serotonin receptor signaling pathway	IDA	35714614, 36989299, 37327704
GO:0007268	Process	Chemical synaptic transmission	IBA
GO:0007268	Process	Chemical synaptic transmission	TAS	8522988
GO:0010647	Process	Positive regulation of cell communication	IEA
GO:0016020	Component	Membrane	IEA
GO:0021795	Process	Cerebral cortex cell migration	IEA
GO:0021795	Process	Cerebral cortex cell migration	ISS
GO:0023056	Process	Positive regulation of signaling	IEA
GO:0030425	Component	Dendrite	IBA
GO:0030594	Function	Neurotransmitter receptor activity	IBA
GO:0032008	Process	Positive regulation of TOR signaling	IDA	23027611
GO:0032008	Process	Positive regulation of TOR signaling	IEA
GO:0045202	Component	Synapse	IEA
GO:0098664	Process	G protein-coupled serotonin receptor signaling pathway	IEA
GO:0099589	Function	Serotonin receptor activity	IDA	35714614

Other IDs

• MIM: 601109
• HGNC: 5301
• e!Ensembl: ENSG00000158748

Protein

• UniProt ID: P50406
• Protein name: 5-hydroxytryptamine receptor 6 (5-HT-6) (5-HT6) (Serotonin receptor 6)
• Protein function: G-protein coupled receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone and a mitogen (PubMed:35714614, PubMed:36989299, PubMed:37327704, PubMed:8522988). Also has a high affinity for tr
• PDB: 7XTB, 7YS6, 8JLZ
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	43 → 320	7 transmembrane receptor (rhodopsin family)	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in several human brain regions, most prominently in the caudate nucleus. {ECO:0000269|PubMed:8522988}.
• Sequence:

  MVPEPGPTANSTPAWGAGPPSAPGGSGWVAAALCVVIALTAAANSLLIALICTQPALRNT
  SNFFLVSLFTSDLMVGLVVMPPAMLNALYGRWVLARGLCLLWTAFDVMCCSASILNLCLI
  SLDRYLLILSPLRYKLRMTPLRALALVLGAWSLAALASFLPLLLGWHELGHARPPVPGQC
  RLLASLPFVLVASGLTFFLPSGAICFTYCRILLAARKQAVQVASLTTGMASQASETLQVP
  RTPRPGVESADSRRLATKHSRKALKASLTLGILLGMFFVTWLPFFVANIVQAVCDCISPG
  LFDVLTWLGYCNSTMNPIIYPLFMRDFKRALGRFLPCPRCPRERQASLASPSLRTSHSGP
  RPGLSLQQVLPLPLPPDSDSDSDAGSGGSSGLRLTAQLLLPGEATQDPPLPTRAAAAVNF
  FNIDPAEPELRPHPLGIPTN

• Sequence length: 440

Pathways

KEGG:

Calcium signaling pathway
cAMP signaling pathway
Neuroactive ligand-receptor interaction
Serotonergic synapse

Reactome:

Serotonin receptors
G alpha (s) signalling events
ADORA2B mediated anti-inflammatory cytokines production

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMERS DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMPHETAMINE OR RELATED ACTING SYMPATHOMIMETIC ABUSE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMPHETAMINE-RELATED DISORDERS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR I DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MEMORY DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METACHRONOUS COLORECTAL ADENOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHOSES, SUBSTANCE-INDUCED	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Age-Related Memory Disorders	Age-Related Memory Disorders	CTD_human_DG	19733250		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	15531082		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	16005519, 29204799		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	16005519, 29204799		★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	16701945		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	10893499		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	35359970	Inhibit	★☆☆☆☆ Found in Text Mining only
Delusions	Delusions	BEFREE	15882132		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	11725820, 16005519, 29380267		★☆☆☆☆ Found in Text Mining only
Dementia, Vascular	Dementia	BEFREE	28196966		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	11442897, 26449188		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	8883928		★☆☆☆☆ Found in Text Mining only
Hallucinations	Hallucinations	BEFREE	15882132		★☆☆☆☆ Found in Text Mining only
Hyperprolactinemia	Hyperprolactinemia	BEFREE	27654063		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	28141622, 28931427, 29502275		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 1	Major Affective Disorder	BEFREE	10893499		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 2	Major Affective Disorder	BEFREE	10893499		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 4	Major Affective Disorder	BEFREE	10893499		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 6	Major Affective Disorder	BEFREE	10893499		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 7	Major Affective Disorder	BEFREE	10893499		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 8	Major Affective Disorder	BEFREE	10893499		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 9	Major Affective Disorder	BEFREE	10893499		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	11702016, 15823158, 20737521		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	28958176		★☆☆☆☆ Found in Text Mining only
Memory Disorders	Memory Disorders	CTD_human_DG	19733250		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	BEFREE	11442897, 26449188		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	Pubtator	31587366	Associate	★☆☆☆☆ Found in Text Mining only
Mixed anxiety and depressive disorder	Mixed Anxiety And Depressive Disorder	BEFREE	29626125		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	10581475, 20394784		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood Disorder	PSYGENET_DG	10581475, 18206183, 20394784		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	BEFREE	28550249		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	LHGDN	11889255		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	11725820, 16005519, 29380267		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	20705401		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	10206228, 10477121, 10893499, 11163544, 11524147, 12057822, 15048641, 15205874, 16005519, 18855532, 22745941, 27654063, 27829340, 28029458, 28141622, 29715539		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	CTD_human_DG	12165372		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	LHGDN	15048641		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Shared Paranoid Disorder	Shared Paranoid Disorder	BEFREE	20705401		★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	15823158		★☆☆☆☆ Found in Text Mining only