HTR3A (5-hydroxytryptamine receptor 3A)

Gene

• Entrez ID: 3359
• Gene name: 5-hydroxytryptamine receptor 3A
• Gene symbol: HTR3A
• Synonyms (NCBI Gene): 5-HT-3, 5-HT3A, 5-HT3R, 5HT3R, HTR3
• Chromosome: 11
• Chromosome location: 11q23.2
• Summary: The product of this gene belongs to the ligand-gated ion channel receptor superfamily. This gene encodes subunit A of the type 3 receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitoge

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT021413	hsa-miR-9-5p	Microarray	17612493
MIRT1057238	hsa-miR-3160-3p	CLIP-seq
MIRT1057239	hsa-miR-4307	CLIP-seq
MIRT1057240	hsa-miR-4487	CLIP-seq
MIRT1057241	hsa-miR-4710	CLIP-seq
MIRT1057242	hsa-miR-4792	CLIP-seq
MIRT1057243	hsa-miR-558	CLIP-seq
MIRT1549700	hsa-miR-1587	CLIP-seq
MIRT1549701	hsa-miR-378g	CLIP-seq
MIRT1549702	hsa-miR-4492	CLIP-seq
MIRT1549703	hsa-miR-4498	CLIP-seq
MIRT1549704	hsa-miR-4656	CLIP-seq
MIRT1549705	hsa-miR-4675	CLIP-seq
MIRT1549706	hsa-miR-4691-5p	CLIP-seq
MIRT1549707	hsa-miR-4718	CLIP-seq
MIRT1549708	hsa-miR-4741	CLIP-seq
MIRT1549709	hsa-miR-762	CLIP-seq
MIRT1549700	hsa-miR-1587	CLIP-seq
MIRT1549701	hsa-miR-378g	CLIP-seq
MIRT1549702	hsa-miR-4492	CLIP-seq
MIRT1549703	hsa-miR-4498	CLIP-seq
MIRT1549704	hsa-miR-4656	CLIP-seq
MIRT1549705	hsa-miR-4675	CLIP-seq
MIRT1549706	hsa-miR-4691-5p	CLIP-seq
MIRT1549707	hsa-miR-4718	CLIP-seq
MIRT1549708	hsa-miR-4741	CLIP-seq
MIRT1549709	hsa-miR-762	CLIP-seq
MIRT1549700	hsa-miR-1587	CLIP-seq
MIRT1549701	hsa-miR-378g	CLIP-seq
MIRT1549702	hsa-miR-4492	CLIP-seq
MIRT1549703	hsa-miR-4498	CLIP-seq
MIRT1549704	hsa-miR-4656	CLIP-seq
MIRT1549705	hsa-miR-4675	CLIP-seq
MIRT1549706	hsa-miR-4691-5p	CLIP-seq
MIRT1549707	hsa-miR-4718	CLIP-seq
MIRT1549708	hsa-miR-4741	CLIP-seq
MIRT1549709	hsa-miR-762	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004888	Function	Transmembrane signaling receptor activity	IEA
GO:0005216	Function	Monoatomic ion channel activity	IEA
GO:0005230	Function	Extracellular ligand-gated monoatomic ion channel activity	IEA
GO:0005231	Function	Excitatory extracellular ligand-gated monoatomic ion channel activity	IBA
GO:0005515	Function	Protein binding	IPI	17392525
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	9950429
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0007210	Process	Serotonin receptor signaling pathway	IDA	17392525
GO:0007210	Process	Serotonin receptor signaling pathway	IEA
GO:0007268	Process	Chemical synaptic transmission	IBA
GO:0015276	Function	Ligand-gated monoatomic ion channel activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0022850	Function	Serotonin-gated monoatomic cation channel activity	IBA
GO:0022850	Function	Serotonin-gated monoatomic cation channel activity	IDA	7565620, 9950429, 10521471
GO:0022850	Function	Serotonin-gated monoatomic cation channel activity	IEA
GO:0032154	Component	Cleavage furrow	IDA	19799413
GO:0034220	Process	Monoatomic ion transmembrane transport	IBA
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0042391	Process	Regulation of membrane potential	IBA
GO:0042802	Function	Identical protein binding	IEA
GO:0043005	Component	Neuron projection	IBA
GO:0045202	Component	Synapse	IBA
GO:0045202	Component	Synapse	IEA
GO:0045211	Component	Postsynaptic membrane	IEA
GO:0051378	Function	Serotonin binding	IDA	7565620
GO:0060078	Process	Regulation of postsynaptic membrane potential	IEA
GO:0060079	Process	Excitatory postsynaptic potential	IEA
GO:0098662	Process	Inorganic cation transmembrane transport	IDA	17392525
GO:0098662	Process	Inorganic cation transmembrane transport	IEA
GO:0099505	Process	Regulation of presynaptic membrane potential	IEA
GO:0099507	Function	Ligand-gated monoatomic ion channel activity involved in regulation of presynaptic membrane potential	IEA
GO:0140227	Process	Serotonin-gated cation-selective signaling pathway	IDA	10521471
GO:0140227	Process	Serotonin-gated cation-selective signaling pathway	IEA
GO:1902495	Component	Transmembrane transporter complex	IBA
GO:1904315	Function	Transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential	IBA
GO:1904602	Component	Serotonin-activated cation-selective channel complex	IDA	9950429
GO:1904602	Component	Serotonin-activated cation-selective channel complex	IEA
GO:1904602	Component	Serotonin-activated cation-selective channel complex	IPI	16116092, 17392525

Other IDs

• MIM: 182139
• HGNC: 5297
• e!Ensembl: ENSG00000166736

Protein

• UniProt ID: P46098
• Protein name: 5-hydroxytryptamine receptor 3A (5-HT3-A) (5-HT3A) (5-hydroxytryptamine receptor 3) (5-HT-3) (5-HT3R) (Serotonin receptor 3A) (Serotonin-gated ion channel receptor)
• Protein function: Forms serotonin (5-hydroxytryptamine/5-HT3)-activated cation-selective channel complexes, which when activated cause fast, depolarizing responses in neurons. {ECO:0000269|PubMed:10521471, ECO:0000269|PubMed:12867984, ECO:0000269|PubMed:17392525,
• PDB: 8AXD, 8BL8, 8BLA, 8BLB
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02931	Neur_chan_LBD	35 → 242	Neurotransmitter-gated ion-channel ligand binding domain	Family
  PF02932	Neur_chan_memb	249 → 469	Neurotransmitter-gated ion-channel transmembrane region	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in cerebral cortex, amygdala, hippocampus, and testis. Detected in monocytes of the spleen and tonsil, in small and large intestine, uterus, prostate, ovary and placenta. {ECO:0000269|PubMed:10521471}.
• Sequence:

  MLLWVQQALLALLLPTLLAQGEARRSRNTTRPALLRLSDYLLTNYRKGVRPVRDWRKPTT
  VSIDVIVYAILNVDEKNQVLTTYIWYRQYWTDEFLQWNPEDFDNITKLSIPTDSIWVPDI
  LINEFVDVGKSPNIPYVYIRHQGEVQNYKPLQVVTACSLDIYNFPFDVQNCSLTFTSWLH
  TIQDINISLWRLPEKVKSDRSVFMNQGEWELLGVLPYFREFSMESSNYYAEMKFYVVIRR
  RPLFYVVSLLLPSIFLMVMDIVGFYLPPNSGERVSFKITLLLGYSVFLIIVSDTLPATAI
  GTPLIGVYFVVCMALLVISLAETIFIVRLVHKQDLQQPVPAWLRHLVLERIAWLLCLREQ
  STSQRPPATSQATKTDDCSAMGNHCSHMGGPQDFEKSPRDRCSPPPPPREASLAVCGLLQ
  ELSSIRQFLEKRDEIREVARDWLRVGSVLDKLLFHIYLLAVLAYSITLVMLWSIWQYA

• Sequence length: 478

Pathways

KEGG:

Serotonergic synapse
Taste transduction

Reactome:

Neurotransmitter receptors and postsynaptic signal transmission

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMPHETAMINE OR RELATED ACTING SYMPATHOMIMETIC ABUSE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMPHETAMINE-RELATED DISORDERS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISTIC DISORDER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IRRITABLE BOWEL SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LATE-ONSET ALZHEIMER'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	9299238		★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia	BEFREE	19741568		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	21420406, 22014438, 28493335		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety disorder	Pubtator	21420406, 22014438, 33767348, 35800179	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	21420406, 22014438, 28493335		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety disorder	Pubtator	21420406	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	24338226	Associate	★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	30074224		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	19184136		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	CTD_human_DG	19184136		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	Pubtator	19184136	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	BEFREE	11505217, 22832903, 27706728		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	11505217, 22832903		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	27706728	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Borderline Personality Disorder	Borderline personality disorder	BEFREE	19032968		★☆☆☆☆ Found in Text Mining only
Bulimia Nervosa	Bulimia	BEFREE	19741568		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	27022227	Associate	★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	19741568, 20728877, 22014438, 28439104, 28493335		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	PSYGENET_DG	19741568, 20728877, 21937687, 22014438		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder	Major depressive disorder	Pubtator	22014438, 33767348, 35800179	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Down Syndrome	Down syndrome	Pubtator	27293319	Associate	★☆☆☆☆ Found in Text Mining only
Dyspepsia	Dysphasia	Pubtator	21192076, 22014438	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	34022433	Associate	★☆☆☆☆ Found in Text Mining only
Gilles de la Tourette syndrome	Tourette Syndrome	BEFREE	16314763, 23126479		★☆☆☆☆ Found in Text Mining only
Gilles de la Tourette syndrome	Tourette Syndrome	LHGDN	16314763		★☆☆☆☆ Found in Text Mining only
Hypocholesterolemia	Hypocholesterolemia	BEFREE	20200506		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	LHGDN	17052218, 18614545		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	18363639, 21345729, 21420406, 22403795, 28205278		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	21192076, 21420406, 35800179	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	27022227	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR AFFECTIVE DISORDER 1	Major Affective Disorder	BEFREE	11505217, 22832903		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 2	Major Affective Disorder	BEFREE	11505217, 22832903		★☆☆☆☆ Found in Text Mining only
Major Affective Disorder 2	Major depressive disorder	Pubtator	22832903	Associate	★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 4	Major Affective Disorder	BEFREE	11505217, 22832903		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 6	Major Affective Disorder	BEFREE	11505217, 22832903		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 7	Major Affective Disorder	BEFREE	11505217		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 8	Major Affective Disorder	BEFREE	11505217		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 9	Major Affective Disorder	BEFREE	11505217		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	16487942, 28125323		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	PSYGENET_DG	16487942, 21937687		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant Neoplasms	Malignant Neoplasm	BEFREE	16338277		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	19741568, 20728877, 22014438, 28439104, 28493335		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	PSYGENET_DG	19741568, 20694966, 20728877, 21937687, 22014438		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental disorders	Mental Disorders	BEFREE	16487942, 21345729, 26350166, 26701104		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	16487942, 20694966		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood Disorder	PSYGENET_DG	16487942, 20694966		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nausea	Nausea	Pubtator	33794950	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	27716384		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	26381270		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	33767348	Associate	★☆☆☆☆ Found in Text Mining only
Obsessive-Compulsive Disorder	Obsessive-Compulsive Disorder	BEFREE	17259209, 23928294, 27616601		★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic Disorder	LHGDN	18197086		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	28057070	Stimulate	★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	27720744		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	16794822		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	11207027, 16487942, 18622264, 20168265, 20356718, 21184810, 22700043, 23126479		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	20356718, 21184810		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Testicular regression syndrome	Testicular regression syndrome	BEFREE	18359159, 22700043		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	35757399	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	27022227		★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	16487942, 28125323		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	PSYGENET_DG	16487942, 21937687		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vascular Malformations	Vascular malformation	Pubtator	27716384	Associate	★☆☆☆☆ Found in Text Mining only