HTR2C (5-hydroxytryptamine receptor 2C)

Gene

• Entrez ID: 3358
• Gene name: 5-hydroxytryptamine receptor 2C
• Gene symbol: HTR2C
• Synonyms (NCBI Gene): 5-HT1C, 5-HT2C, 5-HTR2C, 5HTR2C, HTR1C
• Chromosome: X
• Chromosome location: Xq23
• Summary: This gene encodes a seven-transmembrane G-protein-coupled receptor. The encoded protein responds to signaling through the neurotransmitter serotonin. The mRNA of this gene is subject to multiple RNA editing events, where adenosine residues encoded by the

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs1414334	C>G	Drug-response, benign	Intron variant
rs3813929	C>G,T	Drug-response	Upstream transcript variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT005901	hsa-miR-22-3p	Luciferase reporter assay, Microarray	21168126
MIRT1057223	hsa-miR-1324	CLIP-seq
MIRT1057224	hsa-miR-3120-3p	CLIP-seq
MIRT1057225	hsa-miR-323-3p	CLIP-seq
MIRT1057226	hsa-miR-3529	CLIP-seq
MIRT1057227	hsa-miR-3714	CLIP-seq
MIRT1057228	hsa-miR-379	CLIP-seq
MIRT1057229	hsa-miR-3927	CLIP-seq
MIRT1057230	hsa-miR-3942-3p	CLIP-seq
MIRT1057231	hsa-miR-3942-5p	CLIP-seq
MIRT1057232	hsa-miR-4699-3p	CLIP-seq
MIRT1057233	hsa-miR-4703-5p	CLIP-seq
MIRT1057234	hsa-miR-4708-3p	CLIP-seq
MIRT1057235	hsa-miR-4736	CLIP-seq
MIRT1057236	hsa-miR-4742-5p	CLIP-seq
MIRT1057237	hsa-miR-940	CLIP-seq
MIRT2013074	hsa-miR-1290	CLIP-seq
MIRT2013075	hsa-miR-4263	CLIP-seq
MIRT2013076	hsa-miR-450b-5p	CLIP-seq
MIRT2013077	hsa-miR-4719	CLIP-seq
MIRT2013078	hsa-miR-4802-3p	CLIP-seq
MIRT2013079	hsa-miR-513b	CLIP-seq
MIRT2013080	hsa-miR-555	CLIP-seq
MIRT2245370	hsa-miR-1252	CLIP-seq
MIRT1057223	hsa-miR-1324	CLIP-seq
MIRT1057224	hsa-miR-3120-3p	CLIP-seq
MIRT1057230	hsa-miR-3942-3p	CLIP-seq
MIRT1057231	hsa-miR-3942-5p	CLIP-seq
MIRT1057232	hsa-miR-4699-3p	CLIP-seq
MIRT1057233	hsa-miR-4703-5p	CLIP-seq
MIRT2451471	hsa-miR-4677-3p	CLIP-seq
MIRT2451472	hsa-miR-495	CLIP-seq
MIRT2451473	hsa-miR-610	CLIP-seq
MIRT2548615	hsa-miR-3130-3p	CLIP-seq
MIRT2548616	hsa-miR-3664-5p	CLIP-seq
MIRT2548617	hsa-miR-4714-5p	CLIP-seq
MIRT2548618	hsa-miR-4793-3p	CLIP-seq
MIRT2548619	hsa-miR-568	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001587	Function	Gq/11-coupled serotonin receptor activity	IDA	18703043, 29398112
GO:0001662	Process	Behavioral fear response	IEA
GO:0001662	Process	Behavioral fear response	ISS
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004993	Function	G protein-coupled serotonin receptor activity	IBA
GO:0004993	Function	G protein-coupled serotonin receptor activity	IDA	7582481, 12970106
GO:0004993	Function	G protein-coupled serotonin receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	14988405, 25770211, 28258217, 28514442, 30157263, 32296183, 33961781
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	12970106, 18703043
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	IMP	18703043
GO:0005886	Component	Plasma membrane	TAS
GO:0006874	Process	Intracellular calcium ion homeostasis	IDA	19057895
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007187	Process	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	IBA
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IEA
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	ISS
GO:0007208	Process	Phospholipase C-activating serotonin receptor signaling pathway	IBA
GO:0007208	Process	Phospholipase C-activating serotonin receptor signaling pathway	IDA	20966218, 37991948
GO:0007208	Process	Phospholipase C-activating serotonin receptor signaling pathway	IDA	12970106, 29398112
GO:0007208	Process	Phospholipase C-activating serotonin receptor signaling pathway	IEA
GO:0007208	Process	Phospholipase C-activating serotonin receptor signaling pathway	ISS
GO:0007210	Process	Serotonin receptor signaling pathway	IBA
GO:0007268	Process	Chemical synaptic transmission	IBA
GO:0007268	Process	Chemical synaptic transmission	TAS	9241279
GO:0007626	Process	Locomotory behavior	IEA
GO:0007631	Process	Feeding behavior	IEA
GO:0007631	Process	Feeding behavior	ISS
GO:0007631	Process	Feeding behavior	TAS	7700379
GO:0010513	Process	Positive regulation of phosphatidylinositol biosynthetic process	IDA	19057895
GO:0016020	Component	Membrane	IEA
GO:0019934	Process	CGMP-mediated signaling	IDA	12970106
GO:0030425	Component	Dendrite	IBA
GO:0030594	Function	Neurotransmitter receptor activity	IBA
GO:0031644	Process	Regulation of nervous system process	IEA
GO:0031644	Process	Regulation of nervous system process	ISS
GO:0032098	Process	Regulation of appetite	IEA
GO:0032098	Process	Regulation of appetite	ISS
GO:0042802	Function	Identical protein binding	IPI	15518545, 16195233, 25770211, 28258217
GO:0043397	Process	Regulation of corticotropin-releasing hormone secretion	IEA
GO:0043397	Process	Regulation of corticotropin-releasing hormone secretion	ISS
GO:0045202	Component	Synapse	IEA
GO:0045600	Process	Positive regulation of fat cell differentiation	IEA
GO:0050850	Process	Positive regulation of calcium-mediated signaling	IEA
GO:0051209	Process	Release of sequestered calcium ion into cytosol	IBA
GO:0051209	Process	Release of sequestered calcium ion into cytosol	IMP	18703043
GO:0051378	Function	Serotonin binding	IDA	7582481, 12970106, 15831837, 18703043, 19057895
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IDA	19057895
GO:0071886	Function	1-(4-iodo-2,5-dimethoxyphenyl)propan-2-amine binding	IDA	19057895
GO:0098664	Process	G protein-coupled serotonin receptor signaling pathway	IDA	18703043
GO:0098666	Component	G protein-coupled serotonin receptor complex	IDA	12970106, 18703043
GO:0099589	Function	Serotonin receptor activity	IDA	29398112
GO:0099589	Function	Serotonin receptor activity	IEA

Other IDs

• MIM: 312861
• HGNC: 5295
• e!Ensembl: ENSG00000147246

Protein

• UniProt ID: P28335
• Protein name: 5-hydroxytryptamine receptor 2C (5-HT-2C) (5-HT2C) (5-HTR2C) (5-hydroxytryptamine receptor 1C) (5-HT-1C) (5-HT1C) (Serotonin receptor 2C)
• Protein function: G-protein coupled receptor for 5-hydroxytryptamine (serotonin) (PubMed:12970106, PubMed:18703043, PubMed:19057895, PubMed:29398112, PubMed:7895773). Also functions as a receptor for various drugs and psychoactive substances, including ergot alka
• PDB: 6BQG, 6BQH, 8DPF, 8DPG, 8DPH, 8DPI, 8ZMF
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	70 → 368	7 transmembrane receptor (rhodopsin family)	Family

• Tissue specificity: TISSUE SPECIFICITY: Detected in brain. {ECO:0000269|PubMed:8812491}.
• Sequence:

  MVNLRNAVHSFLVHLIGLLVWQCDISVSPVAAIVTDIFNTSDGGRFKFPDGVQNWPALSI
  VIIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYVW
  PLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVWA
  ISIGVSVPIPVIGLRDEEKVFVNNTTCVLNDPNFVLIGSFVAFFIPLTIMVITYCLTIYV
  LRRQALMLLHGHTEEPPGLSLDFLKCCKRNTAEEENSANPNQDQNARRRKKKERRPRGTM
  QAINNERKASKVLGIVFFVFLIMWCPFFITNILSVLCEKSCNQKLMEKLLNVFVWIGYVC
  SGINPLVYTLFNKIYRRAFSNYLRCNYKVEKKPPVRQIPRVAATALSGRELNVNIYRHTN
  EPVIEKASDNEPGIEMQVENLELPVNPSSVVSERISSV

• Sequence length: 458

Pathways

KEGG:

Calcium signaling pathway
Neuroactive ligand-receptor interaction
Gap junction
Serotonergic synapse
Inflammatory mediator regulation of TRP channels

Reactome:

Serotonin receptors
G alpha (q) signalling events

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BIPOLAR DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR I DISORDER, MOST RECENT EPISODE MANIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSION, BIPOLAR	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HTR2C POLYMORPHISM	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HTR2C-related disorder	Uncertain significance; Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERKINESIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERKINESIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME X	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIXED BIPOLAR I DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate cancer	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEASONAL AFFECTIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE WITHDRAWAL SYNDROME	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Alzheimer Disease	Alzheimer disease	Pubtator	22766135, 26303700	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	9700207		★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia	BEFREE	10624828, 12858032, 30554102		★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia	LHGDN	12858032		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	11287788, 15313842, 18772038, 23247076, 29545208, 30685402		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	11287788, 15313842, 18772038, 23247076, 29545208, 30685402		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	37238670	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	24386118	Associate	★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	14574222, 16741915, 16959425, 30074224		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	21186965	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	19038234		★☆☆☆☆ Found in Text Mining only
Autistic behavior	Autism	BEFREE	21186965		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	10374746, 30862860		★☆☆☆☆ Found in Text Mining only
Avoidant Restrictive Food Intake Disorder	Avoidant restrictive food intake disorder	Pubtator	35700837	Associate	★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	20494452		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	11502363, 12111480, 20015120, 20494452, 22404657, 28174802, 8823764, 9342201		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	18504633, 19411841, 20015120, 20494452, 22404657		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	20015120, 28174802	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar I disorder	Bipolar Disorder	BEFREE	25596490		★☆☆☆☆ Found in Text Mining only
Borderline Personality Disorder	Borderline personality disorder	BEFREE	19032968, 22404657		★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	22404657		★☆☆☆☆ Found in Text Mining only
Bulimia	Bulimia	BEFREE	10412190		★☆☆☆☆ Found in Text Mining only
Bulimia Nervosa	Bulimia	BEFREE	10412190, 10624828		★☆☆☆☆ Found in Text Mining only
Bulimia Nervosa	Bulimia	LHGDN	17055531		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	21967853, 24386118		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	21967853, 24386118	Associate	★☆☆☆☆ Found in Text Mining only
Chronic schizophrenia	Schizophrenia	BEFREE	25304226		★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	28664341		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	22766135, 29924134	Associate	★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	24196946		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	24386118	Associate	★☆☆☆☆ Found in Text Mining only
Delirium	Delirium	BEFREE	10206230		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	22766135	Associate	★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	12707936, 15093687, 15313842, 16799258, 18772038, 19708722, 23583320, 23719026, 25514629, 26739950, 29969651		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	PSYGENET_DG	20624407, 23049953, 23583320, 23719026, 24770757		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder	Major depressive disorder	Pubtator	21967853	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder Major	Major depressive disorder	Pubtator	20015120	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	19931306		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	19931306		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	28174802	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	21967853, 28977211	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	10768099, 18192901, 21967853		★☆☆☆☆ Found in Text Mining only
Disruptive, Impulse Control, and Conduct Disorders	Impulse control disorder	BEFREE	31288724		★☆☆☆☆ Found in Text Mining only
Dyskinesia, Drug-Induced	Dyskinesia	BEFREE	15953671		★☆☆☆☆ Found in Text Mining only
Dyskinetic syndrome	Dyskinetic Syndrome	BEFREE	19439249		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	20562674		★☆☆☆☆ Found in Text Mining only
Eating Disorders	Eating Disorders	BEFREE	10412190, 11287788, 15551195		★☆☆☆☆ Found in Text Mining only
Extrapyramidal Disorders	Extrapyramidal disease	BEFREE	18562401		★☆☆☆☆ Found in Text Mining only
Gilles de la Tourette syndrome	Tourette Syndrome	BEFREE	20010450, 22914617		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	8883928		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	31496784		★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	28174802		★☆☆☆☆ Found in Text Mining only
Hyperprolactinemia	Hyperprolactinemia	BEFREE	26682995, 27654063, 31520576		★☆☆☆☆ Found in Text Mining only
Hyperprolactinemia	Hyperproinsulinemia	Pubtator	27654063, 31520576	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic generalized epilepsy	Epilepsy	BEFREE	10206230		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	24196946		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	26933844	Associate	★☆☆☆☆ Found in Text Mining only
Lingual-Facial-Buccal Dyskinesia	Orofacial dyskinesia	BEFREE	11140333		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 1	Major Affective Disorder	BEFREE	11502363, 8823764		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 2	Major Affective Disorder	BEFREE	11502363, 8823764		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 4	Major Affective Disorder	BEFREE	11502363, 8823764		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 6	Major Affective Disorder	BEFREE	11502363, 8823764		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 7	Major Affective Disorder	BEFREE	11502363, 8823764		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 8	Major Affective Disorder	BEFREE	11502363, 8823764		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 9	Major Affective Disorder	BEFREE	11502363, 8823764		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	11282248, 12707936, 12853111, 12934707, 15927089, 19411841, 19708722, 20015120, 20065966, 22404657, 23765961		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	PSYGENET_DG	20015120, 20065966, 22404657, 23765961, 24781207		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15093687		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	15093687, 15313842, 16799258, 18772038, 19708722, 23583320, 23719026, 25514629, 26739950, 29969651		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	PSYGENET_DG	20624407, 23049953, 23583320, 23719026, 24770757		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental disorders	Mental Disorders	BEFREE	10412190, 11282248, 12853111, 17168843, 17307311, 18802918, 19411841, 20015120, 25732952, 26739950, 29924134		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	27681143, 28492956	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	17632216, 19142101, 20680028, 21185157, 25152019, 26359410, 26621002, 27681143, 28492956, 28879574, 29441581		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Syndrome X	Metabolic Syndrome	CTD_human_DG	17632216, 18515891, 19142101		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Migraine Disorders	Migraine	BEFREE	12555241, 17901921, 8675433, 9295094		★☆☆☆☆ Found in Text Mining only
Migraine with Aura	Migraine with Aura	BEFREE	15109354, 15147464, 17901921		★☆☆☆☆ Found in Text Mining only
Migraine with Aura	Migraine with Aura	LHGDN	15147464, 17901921		★☆☆☆☆ Found in Text Mining only
Mixed anxiety and depressive disorder	Mixed Anxiety And Depressive Disorder	BEFREE	31288724		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	11526472, 14996615, 18715570, 22764241, 25596490		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood Disorder	PSYGENET_DG	18715570, 19614978, 19775499, 22764241, 25596490		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood disorder	Pubtator	29709878	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Movement Disorders	Movement Disorders	BEFREE	23226551		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	24386118	Associate	★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	28977211	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	18664619, 18772044		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	17376412, 8931486		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	30862860		★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	15313842, 15864111, 31496784		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	10768099, 12678838, 15048662, 16021472, 17016522, 17168843, 17291373, 17702092, 18192901, 18252809, 19142110, 20065966, 21105285, 21510767, 23537943, 28296064, 29601948, 29969651, 30146485, 30157263, 30862860, 31288724, 9200673		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	16258205, 19690620, 23161547, 28977211	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	CTD_human_DG	17702092, 19142110		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity Abdominal	Obesity	Pubtator	28492956	Associate	★☆☆☆☆ Found in Text Mining only
Obsessive-Compulsive Disorder	Obsessive-Compulsive Disorder	BEFREE	28576508, 29225044, 30554102, 31187473		★☆☆☆☆ Found in Text Mining only
Osteofibrous Dysplasia	Osteofibrous Dysplasia	BEFREE	11140333		★☆☆☆☆ Found in Text Mining only
Pancreatitis, Acute Necrotizing	Necrotizing pancreatitis	BEFREE	26359410		★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic Disorder	BEFREE	12759158		★☆☆☆☆ Found in Text Mining only
Parkinson Disease Secondary	Secondary parkinson disease	Pubtator	18389501	Associate	★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	BEFREE	23226551, 23609402		★☆☆☆☆ Found in Text Mining only
Pervasive Development Disorder	Autism spectrum disorder	BEFREE	21186965		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	29601948		★☆☆☆☆ Found in Text Mining only
Polyneuropathy	Polyneuropathy	BEFREE	21614492		★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	30792491		★☆☆☆☆ Found in Text Mining only
Prader-Willi Syndrome	Prader-Willi Syndrome	BEFREE	19304781, 22495932, 23494383, 28296064, 29969651, 30353709		★☆☆☆☆ Found in Text Mining only
Psychomotor Agitation	Psychiatric disorders	Pubtator	26303700	Associate	★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	15313842, 15864111, 31496784		★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	28977211	Associate	★☆☆☆☆ Found in Text Mining only
Recurrent major depressive episodes	Mental Depression	BEFREE	11526472		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	11282248, 11443520, 12086765, 12934707, 14643089, 15695058, 15717293, 17275977, 17632216, 18205001, 18839076, 18855532, 19142101, 19411841, 20015120, 20045196, 20195292, 21185157, 22404657, 22967772, 25152019, 25284335, 25304226, 26739950, 27414739, 28174802, 29912792, 30157263, 30332506, 31288724, 8742444, 9285964		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	LHGDN	15167695, 15318026, 15953671		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	18718676, 20015120, 29032150	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	20195292, 21185157, 22404657, 22967772		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Seasonal Affective Disorder	Seasonal Affective Disorder	PSYGENET_DG	11300730, 16157158		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Seasonal Affective Disorder	Seasonal Affective Disorder	BEFREE	16157158		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Severe depression	Mental Depression	BEFREE	15093687		★☆☆☆☆ Found in Text Mining only
Symmetrical dyschromatosis of extremities	Symmetrical Dyschromatosis Of Extremities	BEFREE	11097073		★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous Sclerosis	BEFREE	19005330		★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	11282248, 12853111, 12934707, 19411841, 20015120, 22404657, 23765961		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	PSYGENET_DG	20015120, 20065966, 22404657, 23765961, 24781207		★★☆☆☆ Found in Text Mining + Unknown/Other Associations