HTR2A (5-hydroxytryptamine receptor 2A)

Gene

• Entrez ID: 3356
• Gene name: 5-hydroxytryptamine receptor 2A
• Gene symbol: HTR2A
• Synonyms (NCBI Gene): 5-HT2A, HTR2
• Chromosome: 13
• Chromosome location: 13q14.2
• Summary: This gene encodes one of the receptors for serotonin, a neurotransmitter with many roles. Mutations in this gene are associated with susceptibility to schizophrenia and obsessive-compulsive disorder, and are also associated with response to the antidepres

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs7997012	A>C,G,T	Drug-response, benign	Intron variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT450850	hsa-miR-203a-3p	PAR-CLIP	22100165
MIRT450849	hsa-miR-4251	PAR-CLIP	22100165
MIRT450848	hsa-miR-4329	PAR-CLIP	22100165
MIRT450847	hsa-miR-6761-5p	PAR-CLIP	22100165
MIRT450846	hsa-miR-4303	PAR-CLIP	22100165
MIRT450845	hsa-miR-580-3p	PAR-CLIP	22100165
MIRT450850	hsa-miR-203a-3p	PAR-CLIP	22100165
MIRT450849	hsa-miR-4251	PAR-CLIP	22100165
MIRT450848	hsa-miR-4329	PAR-CLIP	22100165
MIRT450847	hsa-miR-6761-5p	PAR-CLIP	22100165
MIRT450846	hsa-miR-4303	PAR-CLIP	22100165
MIRT450845	hsa-miR-580-3p	PAR-CLIP	22100165
MIRT1057200	hsa-miR-1202	CLIP-seq
MIRT1057201	hsa-miR-1257	CLIP-seq
MIRT1057202	hsa-miR-2964a-5p	CLIP-seq
MIRT1057203	hsa-miR-3117-3p	CLIP-seq
MIRT1057204	hsa-miR-3119	CLIP-seq
MIRT1057205	hsa-miR-3169	CLIP-seq
MIRT1057206	hsa-miR-3194-5p	CLIP-seq
MIRT1057207	hsa-miR-34a	CLIP-seq
MIRT1057208	hsa-miR-34c-5p	CLIP-seq
MIRT1057209	hsa-miR-3611	CLIP-seq
MIRT1057210	hsa-miR-3650	CLIP-seq
MIRT1057211	hsa-miR-3677-5p	CLIP-seq
MIRT1057212	hsa-miR-3972	CLIP-seq
MIRT1057213	hsa-miR-4422	CLIP-seq
MIRT1057214	hsa-miR-4460	CLIP-seq
MIRT1057215	hsa-miR-449a	CLIP-seq
MIRT1057216	hsa-miR-449b	CLIP-seq
MIRT1057217	hsa-miR-4727-3p	CLIP-seq
MIRT1057218	hsa-miR-4756-3p	CLIP-seq
MIRT1057219	hsa-miR-4759	CLIP-seq
MIRT1057220	hsa-miR-522	CLIP-seq
MIRT1057221	hsa-miR-676	CLIP-seq
MIRT1057222	hsa-miR-759	CLIP-seq
MIRT2013073	hsa-miR-4698	CLIP-seq
MIRT2245360	hsa-miR-1321	CLIP-seq
MIRT2245361	hsa-miR-140-3p	CLIP-seq
MIRT2245362	hsa-miR-147	CLIP-seq
MIRT2245363	hsa-miR-3137	CLIP-seq
MIRT2245364	hsa-miR-331-3p	CLIP-seq
MIRT2245365	hsa-miR-3649	CLIP-seq
MIRT2245366	hsa-miR-4270	CLIP-seq
MIRT2245367	hsa-miR-4441	CLIP-seq
MIRT2245368	hsa-miR-4739	CLIP-seq
MIRT2245369	hsa-miR-4756-5p	CLIP-seq
MIRT2548588	hsa-miR-1303	CLIP-seq
MIRT2548589	hsa-miR-1322	CLIP-seq
MIRT2548590	hsa-miR-219-5p	CLIP-seq
MIRT2548591	hsa-miR-27a	CLIP-seq
MIRT2548592	hsa-miR-27b	CLIP-seq
MIRT2548593	hsa-miR-302f	CLIP-seq
MIRT2548594	hsa-miR-3120-3p	CLIP-seq
MIRT2548595	hsa-miR-3123	CLIP-seq
MIRT2548596	hsa-miR-3190	CLIP-seq
MIRT2548597	hsa-miR-371b-5p	CLIP-seq
MIRT2548598	hsa-miR-3925-5p	CLIP-seq
MIRT2548599	hsa-miR-4445	CLIP-seq
MIRT2548600	hsa-miR-4473	CLIP-seq
MIRT2548601	hsa-miR-4699-3p	CLIP-seq
MIRT2548602	hsa-miR-4752	CLIP-seq
MIRT2548603	hsa-miR-4782-3p	CLIP-seq
MIRT2548604	hsa-miR-4790-3p	CLIP-seq
MIRT2548605	hsa-miR-499-3p	CLIP-seq
MIRT2548606	hsa-miR-499a-3p	CLIP-seq
MIRT2548607	hsa-miR-508-3p	CLIP-seq
MIRT2548608	hsa-miR-512-3p	CLIP-seq
MIRT2548609	hsa-miR-513a-5p	CLIP-seq
MIRT2548610	hsa-miR-520f	CLIP-seq
MIRT2548611	hsa-miR-642b	CLIP-seq
MIRT2548612	hsa-miR-767-3p	CLIP-seq
MIRT2548613	hsa-miR-875-5p	CLIP-seq
MIRT2548614	hsa-miR-935	CLIP-seq
MIRT2682485	hsa-miR-1306	CLIP-seq
MIRT2548589	hsa-miR-1322	CLIP-seq
MIRT2682486	hsa-miR-1827	CLIP-seq
MIRT2548590	hsa-miR-219-5p	CLIP-seq
MIRT2548591	hsa-miR-27a	CLIP-seq
MIRT2548592	hsa-miR-27b	CLIP-seq
MIRT2548594	hsa-miR-3120-3p	CLIP-seq
MIRT2682487	hsa-miR-3163	CLIP-seq
MIRT2548596	hsa-miR-3190	CLIP-seq
MIRT2682488	hsa-miR-3662	CLIP-seq
MIRT2548597	hsa-miR-371b-5p	CLIP-seq
MIRT2682489	hsa-miR-4436b-5p	CLIP-seq
MIRT2548599	hsa-miR-4445	CLIP-seq
MIRT2548600	hsa-miR-4473	CLIP-seq
MIRT2548601	hsa-miR-4699-3p	CLIP-seq
MIRT2682490	hsa-miR-4735-5p	CLIP-seq
MIRT2548602	hsa-miR-4752	CLIP-seq
MIRT2682491	hsa-miR-4775	CLIP-seq
MIRT2548603	hsa-miR-4782-3p	CLIP-seq
MIRT2548604	hsa-miR-4790-3p	CLIP-seq
MIRT2548605	hsa-miR-499-3p	CLIP-seq
MIRT2548606	hsa-miR-499a-3p	CLIP-seq
MIRT2548607	hsa-miR-508-3p	CLIP-seq
MIRT2548608	hsa-miR-512-3p	CLIP-seq
MIRT2548609	hsa-miR-513a-5p	CLIP-seq
MIRT2548610	hsa-miR-520f	CLIP-seq
MIRT2682492	hsa-miR-590-3p	CLIP-seq
MIRT2548611	hsa-miR-642b	CLIP-seq
MIRT2682493	hsa-miR-659	CLIP-seq
MIRT2548612	hsa-miR-767-3p	CLIP-seq
MIRT2548613	hsa-miR-875-5p	CLIP-seq
MIRT2548614	hsa-miR-935	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001587	Function	Gq/11-coupled serotonin receptor activity	IDA	18703043, 35084960
GO:0001618	Function	Virus receptor activity	IEA
GO:0001659	Process	Temperature homeostasis	IEA
GO:0002720	Process	Positive regulation of cytokine production involved in immune response	IEA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004993	Function	G protein-coupled serotonin receptor activity	IBA
GO:0004993	Function	G protein-coupled serotonin receptor activity	IDA	7582481, 15862800
GO:0004993	Function	G protein-coupled serotonin receptor activity	IEA
GO:0004993	Function	G protein-coupled serotonin receptor activity	TAS	9109547
GO:0005515	Function	Protein binding	IPI	14988405, 16537434, 18297054, 28258217, 30157263
GO:0005883	Component	Neurofilament	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	15862800, 18703043
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9109547
GO:0005901	Component	Caveola	IEA
GO:0006096	Process	Glycolytic process	IEA
GO:0006874	Process	Intracellular calcium ion homeostasis	IDA	19057895
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007187	Process	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	IBA
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IEA
GO:0007208	Process	Phospholipase C-activating serotonin receptor signaling pathway	IBA
GO:0007208	Process	Phospholipase C-activating serotonin receptor signaling pathway	IDA	20966218, 37991948
GO:0007208	Process	Phospholipase C-activating serotonin receptor signaling pathway	IDA	35084960
GO:0007208	Process	Phospholipase C-activating serotonin receptor signaling pathway	IEA
GO:0007210	Process	Serotonin receptor signaling pathway	IBA
GO:0007210	Process	Serotonin receptor signaling pathway	TAS	9109547
GO:0007268	Process	Chemical synaptic transmission	IBA
GO:0007268	Process	Chemical synaptic transmission	TAS	9109547
GO:0007613	Process	Memory	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0009410	Process	Response to xenobiotic stimulus	IBA
GO:0009410	Process	Response to xenobiotic stimulus	IDA	15862800
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0010513	Process	Positive regulation of phosphatidylinositol biosynthetic process	IDA	19057895
GO:0014059	Process	Regulation of dopamine secretion	IEA
GO:0014824	Process	Artery smooth muscle contraction	IEA
GO:0014832	Process	Urinary bladder smooth muscle contraction	IEA
GO:0016020	Component	Membrane	IEA
GO:0030296	Function	Protein tyrosine kinase activator activity	IEA
GO:0030424	Component	Axon	IEA
GO:0030425	Component	Dendrite	IBA
GO:0030425	Component	Dendrite	IEA
GO:0030594	Function	Neurotransmitter receptor activity	IBA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031652	Process	Positive regulation of heat generation	IEA
GO:0042220	Process	Response to cocaine	IEA
GO:0042734	Component	Presynaptic membrane	IEA
GO:0042802	Function	Identical protein binding	IPI	19279328, 28258217
GO:0042995	Component	Cell projection	IEA
GO:0043025	Component	Neuronal cell body	IEA
GO:0043198	Component	Dendritic shaft	IEA
GO:0043267	Process	Negative regulation of potassium ion transport	IEA
GO:0043525	Process	Positive regulation of neuron apoptotic process	IEA
GO:0044380	Process	Protein localization to cytoskeleton	IEA
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0045202	Component	Synapse	IEA
GO:0045211	Component	Postsynaptic membrane	IEA
GO:0045600	Process	Positive regulation of fat cell differentiation	IEA
GO:0045821	Process	Positive regulation of glycolytic process	IEA
GO:0045907	Process	Positive regulation of vasoconstriction	IEA
GO:0046718	Process	Symbiont entry into host cell	IEA
GO:0046960	Process	Sensitization	IEA
GO:0048148	Process	Behavioral response to cocaine	IEA
GO:0050729	Process	Positive regulation of inflammatory response	IEA
GO:0050951	Process	Sensory perception of temperature stimulus	IEA
GO:0050965	Process	Detection of temperature stimulus involved in sensory perception of pain	IEA
GO:0050966	Process	Detection of mechanical stimulus involved in sensory perception of pain	IEA
GO:0051209	Process	Release of sequestered calcium ion into cytosol	IBA
GO:0051209	Process	Release of sequestered calcium ion into cytosol	IDA	15862800
GO:0051209	Process	Release of sequestered calcium ion into cytosol	IMP	18703043
GO:0051378	Function	Serotonin binding	IDA	7582481, 15831837, 15862800, 18703043, 19057895
GO:0051967	Process	Negative regulation of synaptic transmission, glutamatergic	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IDA	19057895
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IEA
GO:0070852	Component	Cell body fiber	IEA
GO:0071886	Function	1-(4-iodo-2,5-dimethoxyphenyl)propan-2-amine binding	IDA	19057895
GO:0098664	Process	G protein-coupled serotonin receptor signaling pathway	IDA	16517693, 18703043
GO:0098664	Process	G protein-coupled serotonin receptor signaling pathway	IMP	18703043
GO:0098666	Component	G protein-coupled serotonin receptor complex	IDA	18703043
GO:0098793	Component	Presynapse	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099171	Process	Presynaptic modulation of chemical synaptic transmission	IEA
GO:0099589	Function	Serotonin receptor activity	IDA	35084960
GO:0099589	Function	Serotonin receptor activity	IEA
GO:1900119	Process	Positive regulation of execution phase of apoptosis	IEA
GO:1901731	Process	Positive regulation of platelet aggregation	IEA
GO:2000573	Process	Positive regulation of DNA biosynthetic process	IEA

Other IDs

• MIM: 182135
• HGNC: 5293
• e!Ensembl: ENSG00000102468

Protein

• UniProt ID: P28223
• Protein name: 5-hydroxytryptamine receptor 2A (5-HT-2) (5-HT-2A) (Serotonin receptor 2A)
• Protein function: G-protein coupled receptor for 5-hydroxytryptamine (serotonin) (PubMed:1330647, PubMed:18703043, PubMed:19057895, PubMed:21645528, PubMed:22300836, PubMed:35084960, PubMed:38552625). Also functions as a receptor for various drugs and psychoactiv
• PDB: 6A93, 6A94, 6WGT, 6WH4, 6WHA, 7RAN, 7VOD, 7VOE, 7WC4, 7WC5, 7WC6, 7WC7, 7WC8, 7WC9, 8JT8, 8UWL, 8V6U, 8ZMG
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	91 → 380	7 transmembrane receptor (rhodopsin family)	Family

• Tissue specificity: TISSUE SPECIFICITY: Detected in brain cortex (at protein level). Detected in blood platelets. {ECO:0000269|PubMed:18297054}.
• Sequence:

  MDILCEENTSLSSTTNSLMQLNDDTRLYSNDFNSGEANTSDAFNWTVDSENRTNLSCEGC
  LSPSCLSLLHLQEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIAD
  MLLGFLVMPVSMLTILYGYRWPLPSKLCAVWIYLDVLFSTASIMHLCAISLDRYVAIQNP
  IHHSRFNSRTKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGSCLLADDNFVLIGSF
  VSFFIPLTIMVITYFLTIKSLQKEATLCVSDLGTRAKLASFSFLPQSSLSSEKLFQRSIH
  REPGSYTGRRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCNEDVIGA
  LLNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQYKENKKPLQLILVNTIPALAYK
  SSQLQMGQKKNSKQDAKTTDNDCSMVALGKQHSEEASKDNSDGVNEKVSCV

• Sequence length: 471

Pathways

KEGG:

Calcium signaling pathway
Neuroactive ligand-receptor interaction
Gap junction
Serotonergic synapse
Inflammatory mediator regulation of TRP channels

Reactome:

Serotonin receptors
G alpha (q) signalling events

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ASTHMA	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISTIC DISORDER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BASAL GANGLIA DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR I DISORDER, MOST RECENT EPISODE MANIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE AIRWAY DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cocaine-Related Disorders	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COGNITION DISORDERS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DELIRIUM, DEMENTIA, AMNESTIC, COGNITIVE DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSION, BIPOLAR	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER, MAJOR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DYSKINESIAS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DYSKINETIC SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FATTY LIVER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FATTY LIVER, ALCOHOLIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HTR2A-related disorder	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERALGESIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERKINESIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERKINESIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSION, SINGLE EPISODE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	ClinVar, Disgenet ClinVar, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major depressive disorder, response to citalopram therapy in	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MEMORY DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIXED BIPOLAR I DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROBLASTOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBSESSIVE-COMPULSIVE DISORDER	—	CTD, ClinVar, Disgenet CTD, ClinVar, Disgenet CTD, ClinVar, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obsessive-compulsive disorder, susceptibility to	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OROFACIAL CLEFT	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHOTIC DISORDERS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY DISEASE, CHRONIC OBSTRUCTIVE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RECURRENT MAJOR DEPRESSIVE EPISODES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SAPHO SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	CTD, ClinVar, Disgenet CTD, ClinVar, Disgenet CTD, ClinVar, Disgenet CTD, ClinVar, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia, susceptibility to	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEASONAL AFFECTIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEVERE MAJOR DEPRESSION WITH PSYCHOTIC FEATURES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Abdominal Migraine	Abdominal Migraine	CTD_human_DG	12482207		★☆☆☆☆ Found in Text Mining only
Acute Confusional Migraine	Confusional Migraine	CTD_human_DG	12482207		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	16640790, 17525976, 26303700, 34336000	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer disease, familial, type 3	Alzheimer disease	BEFREE	31111219		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	9700207		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	20413853		★☆☆☆☆ Found in Text Mining only
Anorexia	Anorexia	BEFREE	17804117		★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia	BEFREE	10624828, 11134666, 11239910, 11702058, 11803452, 12231269, 15167698, 16397402, 18855537, 19863848, 20545463, 9601682		★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia	LHGDN	11803452, 12231269		★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia nervosa	Pubtator	16087994, 20545463	Associate	★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Antisocial Personality Disorder	Antisocial Personality Disorder	BEFREE	21519306, 22138326		★☆☆☆☆ Found in Text Mining only
Antisocial Personality Disorder	Antisocial personality disorder	Pubtator	36094569	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	15313842, 15777774, 18772038, 25106036, 27912162		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety disorder	Pubtator	23397970, 25041420, 29249830	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	HPO_DG			★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	15313842, 15777774, 18772038, 20383137, 22006095, 25106036, 27912162		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety disorder	Pubtator	37984468	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	16699051, 20179740, 23254357, 36561742	Associate	★☆☆☆☆ Found in Text Mining only
Asthenozoospermia	Asthenozoospermia	BEFREE	29602729		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	37238670	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ataxia	Ataxia	Pubtator	22615781	Associate	★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	11032388, 12167522, 12192616, 12606840, 15802092, 16026119, 16701945, 16741915, 16958038, 17093889, 22825876, 23872233, 30074224		★☆☆☆☆ Found in Text Mining only
Auditory Perceptual Disorders	Auditory perceptual disorder	Pubtator	27230021	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	20628446, 24753316, 24968012	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	17280648, 18592367, 19647026, 24753316, 24887447, 24968012, 26149086, 26262902		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	11920848, 17280648, 20471101, 22030357, 26149086, 8953659		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	Pubtator	17203304, 26262902	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	LHGDN	17280648		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	CTD_human_DG	17280648		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ballismus	Ballismus	CTD_human_DG	11526996		★☆☆☆☆ Found in Text Mining only
Basal Ganglia Diseases	Basal Ganglia Diseases	CTD_human_DG	18480698		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bedwetting	Nocturnal enuresis	BEFREE	21089166		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	39278467	Associate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	10893484, 10898915, 11702051, 11983190, 12622403, 12851635, 14744462, 15948763, 17221840, 19428704, 19584773, 19647327, 21550210, 21598376, 23404241, 25043477, 30178121, 9086465, 9194200, 9341875		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	CTD_human_DG	14708030		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	21550210, 22564712, 23404241, 24962835, 25043477		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	24136241, 27063557, 28751646, 30178121, 31676688, 38377518, 39278467	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	30178121	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar I disorder	Bipolar Disorder	BEFREE	12898571, 24136241		★☆☆☆☆ Found in Text Mining only
Bipolar II disorder	Bipolar Disorder	BEFREE	22564712		★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet disorder	Pubtator	16179957	Associate	★☆☆☆☆ Found in Text Mining only
Borderline Personality Disorder	Borderline personality disorder	BEFREE	11287798, 14744462, 17000047, 22139575, 24355137, 30510522		★☆☆☆☆ Found in Text Mining only
Borderline Personality Disorder	Borderline personality disorder	Pubtator	22139575, 24751216	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	16580628, 22210241		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	35168555	Associate	★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	14744462		★☆☆☆☆ Found in Text Mining only
Bruxism	Bruxism	Pubtator	32367059	Associate	★☆☆☆☆ Found in Text Mining only
Bulimia	Bulimia	BEFREE	17804117, 24257701		★☆☆☆☆ Found in Text Mining only
Bulimia Nervosa	Bulimia	BEFREE	10624828, 15167698, 15245785, 15999344, 17804117		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	37564635	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	21760883		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	36472833	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic	Hypertrophic cardiomyopathy	Pubtator	36657118	Stimulate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	14508013, 17401157, 27597145		★☆☆☆☆ Found in Text Mining only
Central Nervous System Diseases	Central nervous system disease	Pubtator	23158458	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	17401157, 23973249		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	LHGDN	17401157, 17622759		★☆☆☆☆ Found in Text Mining only
Cervical Migraine Syndrome	Migraine	CTD_human_DG	12482207		★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	15950062		★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	LHGDN	15950062		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	22048642, 30219683, 31787571		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	CTD_human_DG	22048642		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic schizophrenia	Schizophrenia	BEFREE	11317227		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	16960982, 23362947		★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	23158458		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	29873956, 30240581, 31500679		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Common Migraine	Common Migraine	BEFREE	8933989		★☆☆☆☆ Found in Text Mining only
Compulsive hoarding	Compulsive Hoarding	HPO_DG			★☆☆☆☆ Found in Text Mining only
Conduct Disorder	Conduct disorder	Pubtator	23457595	Associate	★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	18197083		★☆☆☆☆ Found in Text Mining only
Congenital neurologic anomalies	Drachtman Weinblatt Sitarz syndrome	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	17936780		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	10781645		★☆☆☆☆ Found in Text Mining only
Coronary Artery Vasospasm	Coronary Artery Vasospasm	BEFREE	16960982		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	12600951		★☆☆☆☆ Found in Text Mining only
Cystitis Interstitial	Interstitial cystitis	Pubtator	30973927	Associate	★☆☆☆☆ Found in Text Mining only
Delirium	Delirium	Pubtator	33086708	Associate	★☆☆☆☆ Found in Text Mining only
Delusions	Delusions	BEFREE	19361869, 19494443, 29098976, 30673880		★☆☆☆☆ Found in Text Mining only
Delusions	Delusions	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	11725820, 15000807		★☆☆☆☆ Found in Text Mining only
Depression, Bipolar	Bipolar Disorder	CTD_human_DG	14708030		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depression, Bipolar	Bipolar Disorder	BEFREE	18801406		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	BEFREE	10893484, 12622403, 14508013, 15241435, 16806099, 17069769, 17183148, 17339524, 17510953, 17525976, 18772038, 18801406, 20383137, 21305503, 22210241, 23157339, 23158458, 23537781, 23973249, 24314147, 25106036, 25772786, 26262902, 27912162, 28125323, 28920103, 29865267, 31120232, 31711155, 9084895, 9928234		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder	Major depressive disorder	Pubtator	17525976, 19924111, 22228829, 23158458, 23217578, 24959950, 24968012, 25041420, 26262902, 31676688, 37678326, 37984468	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	PSYGENET_DG	23158458, 23973249, 24314147, 24411530, 25106036		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder Major	Major depressive disorder	Pubtator	20047709	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	LHGDN	18181968		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	19712556		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	19712556		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	19690620, 31152805		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	9767524		★☆☆☆☆ Found in Text Mining only
Diffuse Intrinsic Pontine Glioma	Diffuse Intrinsic Pontine Glioma	BEFREE	30124166		★☆☆☆☆ Found in Text Mining only
Disruptive Impulse Control and Conduct Disorders	Disruptive, impulse control, and conduct disorders	Pubtator	11287798, 19493540, 24751216, 29120849	Associate	★☆☆☆☆ Found in Text Mining only
Disruptive, Impulse Control, and Conduct Disorders	Impulse control disorder	BEFREE	27325396		★☆☆☆☆ Found in Text Mining only
Dyskinetic syndrome	Dyskinetic Syndrome	CTD_human_DG	11526996		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dyskinetic syndrome	Dyskinetic Syndrome	BEFREE	19439249		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EAR, PATELLA, SHORT STATURE SYNDROME	Ear Diseases	BEFREE	27272046		★☆☆☆☆ Found in Text Mining only
Eating Disorders	Eating Disorders	BEFREE	10624828, 11735319, 11950504, 15245785, 18855537, 31199591		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	20736508		★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	16399808, 22681516		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	34912075	Associate	★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	11378836, 17713649		★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	17713649	Associate	★☆☆☆☆ Found in Text Mining only
Extrapyramidal Disorders	Extrapyramidal disease	CTD_human_DG	18480698		★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Fatigue syndrome	Pubtator	20941551	Associate	★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Fatigue syndrome	Pubtator	20941551	Stimulate	★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	26884719, 30446669		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fibrosis, Liver	Liver Fibrosis	BEFREE	29660654, 31344280		★☆☆☆☆ Found in Text Mining only
Fragile X Syndrome	Fragile X Syndrome	BEFREE	23119095		★☆☆☆☆ Found in Text Mining only
Gastroesophageal reflux disease	Gastroesophageal Reflux Disease	BEFREE	11140952		★☆☆☆☆ Found in Text Mining only
Gilles de la Tourette syndrome	Tourette Syndrome	BEFREE	16045972, 17241828, 20010450, 25858583, 31243645		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	37564635	Associate	★☆☆☆☆ Found in Text Mining only
Hallucinations	Hallucinations	BEFREE	15564892, 17481814, 27719624, 29098976, 30318013, 30673880, 30837203		★☆☆☆☆ Found in Text Mining only
Hallucinations	Hallucinations	HPO_DG			★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	17936780		★☆☆☆☆ Found in Text Mining only
Hemiballismus	Hemiballismus	CTD_human_DG	11526996		★☆☆☆☆ Found in Text Mining only
Hemicrania migraine	Hemicrania Migraine	CTD_human_DG	12482207		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	31496784		★☆☆☆☆ Found in Text Mining only
Hyperprolactinemia	Hyperprolactinemia	BEFREE	31520576		★☆☆☆☆ Found in Text Mining only
Hyperprolactinemia	Hyperproinsulinemia	Pubtator	31520576	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	31906879	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension Pulmonary	Pulmonary hypertension	Pubtator	10516655	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	11378836, 15659047, 16778329, 17204265		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	LHGDN	16778329		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperuricemia	Hyperuricemia	BEFREE	16328014		★☆☆☆☆ Found in Text Mining only
Ichthyosis Bullosa of Siemens	Ichthyosis Bullosa Of Siemens	BEFREE	15232358		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	28821451		★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary hypertension	Pulmonary Hypertension	BEFREE	19844076		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	28758583, 29873956, 30240581, 31500679		★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	20198576		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	38492610	Associate	★☆☆☆☆ Found in Text Mining only
Involutional Depression	Involutional Depression	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Involutional paraphrenia	Involutional Paraphrenia	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	15232358, 21325954		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	17401157		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	15247977	Associate	★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	17936780		★☆☆☆☆ Found in Text Mining only
Lenticulostriate Disorders	Lenticulostriate Disorders	CTD_human_DG	18480698		★☆☆☆☆ Found in Text Mining only
Lingual-Facial-Buccal Dyskinesia	Orofacial dyskinesia	CTD_human_DG	11526996		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	16960982, 23362947		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 1	Major Affective Disorder	BEFREE	10893484, 19584773, 9086465, 9194200, 9341875		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 2	Major Affective Disorder	BEFREE	10893484, 19584773, 9086465, 9194200, 9341875		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 4	Major Affective Disorder	BEFREE	10893484, 19584773, 9086465, 9194200, 9341875		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 6	Major Affective Disorder	BEFREE	10893484, 19584773, 9086465, 9194200, 9341875		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 7	Major Affective Disorder	BEFREE	10893484, 19584773, 9086465, 9194200, 9341875		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 8	Major Affective Disorder	BEFREE	10893484, 19584773, 9086465, 9194200, 9341875		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 9	Major Affective Disorder	BEFREE	10893484, 19584773, 9086465, 9194200, 9341875		★☆☆☆☆ Found in Text Mining only
Major depression, single episode	Mental Depression	BEFREE	19758789, 31120232		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major depression, single episode	Mental Depression	PSYGENET_DG	19758789		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	BEFREE	10686553, 11121191, 11311507, 11317230, 11803534, 12422060, 12707936, 12851635, 14730199, 14744462, 15469201, 16127283, 17221840, 19428704, 19560507, 19590397, 19897250, 19937159, 20047709, 21136126, 21741447, 21838737, 22006095, 22480177, 22612784, 23317793, 23404241, 23547754, 24801750, 24962835, 25108775, 25270656, 25990886, 26764241, 27756686, 28125323, 30221791, 31019472, 31111219, 31228794, 31721892		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	PSYGENET_DG	22612784, 24801750, 24962835, 25108775, 25270656		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant Carcinoid Syndrome	Carcinoid tumor of intestine	BEFREE	28594246		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	16580628, 22210241		★☆☆☆☆ Found in Text Mining only
Manic	Manic Disorder	CTD_human_DG	14708030		★☆☆☆☆ Found in Text Mining only
Manic Disorder	Manic Disorder	CTD_human_DG	14708030		★☆☆☆☆ Found in Text Mining only
Maternal hypertension	Maternal hypertension	BEFREE	25223859		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	10893484, 12622403, 14508013, 15241435, 16806099, 17069769, 17183148, 17339524, 17510953, 17525976, 18772038, 18801406, 20383137, 21305503, 22210241, 23157339, 23158458, 23537781, 23973249, 24314147, 25106036, 26262902, 28125323, 28920103, 29865267, 31120232, 31711155, 9928234		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	PSYGENET_DG	23158458, 23537781, 23973249, 24314147, 25106036		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental disorders	Mental Disorders	BEFREE	10464662, 11920859, 12063151, 14744462, 15722960, 16358338, 17691947, 23404241, 24959950, 25043477, 31500679		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	CTD_human_DG	19142110		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	24959950, 28412910		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	11489292, 14668201, 20930387, 8675433		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Migraine Disorders	Migraine	CTD_human_DG	12482207		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Migraine with Aura	Migraine with Aura	BEFREE	20930387		★☆☆☆☆ Found in Text Mining only
Migraine with Aura	Migraine	Pubtator	20930387	Associate	★☆☆☆☆ Found in Text Mining only
Migraine without Aura	Migraine	Pubtator	20930387	Associate	★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	17525976		★☆☆☆☆ Found in Text Mining only
Mixed anxiety and depressive disorder	Mixed Anxiety And Depressive Disorder	BEFREE	20403506, 24411530		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	10482339, 10758249, 10802129, 10893484, 11983190, 11992560, 12063151, 14744462, 15108180, 15483560, 16026119, 18783799, 19361869, 19381154, 19428704, 19584773, 22558144, 31120232, 9084895, 9601682		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood Disorder	LHGDN	14744462		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood Disorder	PSYGENET_DG	19361869, 19381154, 19584773, 20826676, 22558144		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood disorder	Pubtator	20043006, 22558144, 39472813	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Movement Disorders	Movement Disorders	BEFREE	11317228		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	33335118	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	12605580		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	16179957, 17713649	Associate	★☆☆☆☆ Found in Text Mining only
Narcolepsy	Narcolepsy	BEFREE	11444684		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	32986378	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	30777054		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	28177082		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	14751426, 23380172, 8931486		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neuroblastoma	Neuroblastoma	Pubtator	7623119, 9282925, 9831908	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	25041420	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	23380172		★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	21853033		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	30446669		★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	15000807, 15048655, 15313842, 17407792, 17525976, 17614196, 18297054, 19910872, 21550210, 24411530, 27719624, 27955830, 28758583, 30240581		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	12079891, 17922252, 19690620, 21977970, 23537943, 23544600, 24959950, 27228958, 30157263		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	CTD_human_DG	17097612		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	23544600, 23900445, 24959950, 27228958	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obsessive-Compulsive Disorder	Obsessive-Compulsive Disorder	BEFREE	11239910, 12476319, 12650952, 12927326, 15886722, 16443280, 17241828, 17503984, 18191318, 18197083, 20937529, 21874579, 22665263, 24411530, 26616111, 28576508, 29331882, 29785111		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obsessive-Compulsive Disorder	Obsessive-Compulsive Disorder	LHGDN	12476319		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obsessive-Compulsive Disorder	Obsessive-Compulsive Disorder	CTD_human_DG	19644229		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Oral Dyskinesia	Oral Dyskinesia	CTD_human_DG	11526996		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	30777054		★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic Disorder	BEFREE	11444684, 12759158, 15182959, 15722953, 17440930, 18436425, 18832011, 20817074, 22036916, 26390831		★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic Disorder	LHGDN	12759158, 18436425		★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic disorder	Pubtator	20817074, 29249830, 32723321	Associate	★☆☆☆☆ Found in Text Mining only
Paranoid Schizophrenia	Paranoid Schizophrenia	BEFREE	21912188		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	17614196, 21900033, 27325396, 27719624, 27955830, 30673880		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	Pubtator	24398658	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE, LATE-ONSET	Parkinson disease	BEFREE	20817074, 27325396		★☆☆☆☆ Found in Text Mining only
Personality Disorders	Personality Disorders	BEFREE	11287798		★☆☆☆☆ Found in Text Mining only
Pervasive Development Disorder	Autism spectrum disorder	BEFREE	17280648, 19647026, 24753316, 24968012		★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	30632995, 31105836		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	11725820, 15000807		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	16794822, 20198576		★☆☆☆☆ Found in Text Mining only
Psychomotor Agitation	Psychiatric disorders	Pubtator	26303700	Associate	★☆☆☆☆ Found in Text Mining only
Psychosis, Brief Reactive	Psychosis	CTD_human_DG	14708030		★☆☆☆☆ Found in Text Mining only
Psychosis, Involutional	Psychosis	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	CTD_human_DG	14708030		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psychotic Disorders	Psychosis	BEFREE	15000807, 15048655, 15313842, 17221840, 17407792, 17525976, 17614196, 18297054, 19910872, 21550210, 24411530, 27719624, 27955830, 28758583, 30240581, 30318013		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psychotic Disorders	Psychotic disorders	Pubtator	31676688	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Eosinophilia	Pulmonary Eosinophilia	BEFREE	15356103		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	28821451		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	8900237		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	8900237	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	16699051, 18006541, 20179740, 23254357		★☆☆☆☆ Found in Text Mining only
Schizoaffective Disorder	Schizoaffective Disorder	CTD_human_DG	14708030		★☆☆☆☆ Found in Text Mining only
Schizoaffective Disorder	Schizoaffective Disorder	BEFREE	15469201, 19142110, 20521326		★☆☆☆☆ Found in Text Mining only
Schizoaffective disorder, bipolar type	Schizoaffective Disorder	BEFREE	12622403		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	10077731, 10220013, 10650880, 10686553, 10686558, 10754425, 10781645, 10869881, 11317227, 11317228, 11526996, 11574947, 11891796, 12109966, 12606842, 1348924, 14741324, 14744462, 15037867, 15048642, 15083167, 15108180, 15205874, 15383158, 15469201, 15722190, 15802092, 15882132, 15882913, 15893580, 15953671, 16026119, 17069769, 17125970, 17221840, 17221846, 17240119, 17291660, 17407792, 17420819, 17617023, 17688403, 17691947, 17899021, 17924589, 18198266, 18297054, 18420180, 18513383, 18712714, 18783799, 18839076, 19142110, 19352591, 19387614, 19545856, 19913072, 20211215, 20521326, 20623453, 21550210, 21598376, 21912188, 23063294, 23404241, 23592773, 23842608, 23857788, 24962835, 25563748, 26758213, 26812280, 27756686, 28054990, 28154892, 28270751, 29873956, 29896132, 30157263, 30240581, 30281999, 30332506, 30389402, 31228641, 31618004, 31813806, 8622505, 8655141, 8678105, 8703302, 8818400, 8925254, 9259371, 9264136, 9326752, 9694252, 9734554, 9928234		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	LHGDN	12140776, 12624948, 14741324, 14744462, 15048642, 16187138, 17221846, 17240119, 17521439, 17617023, 17688403, 17899021, 17924589, 18420180		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	CTD_human_DG	14708030, 18513383		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	15383158, 18420180, 25041420, 29032150, 36641432, 37564635	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia and related disorders	Schizophrenia	BEFREE	15952869		★☆☆☆☆ Found in Text Mining only
Schizophreniform Disorders	Schizophreniform Disorders	CTD_human_DG	14708030		★☆☆☆☆ Found in Text Mining only
Seasonal Affective Disorder	Seasonal Affective Disorder	BEFREE	10089016, 11244145, 11735319, 12167522, 16899354, 20580209, 8959291		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Seasonal Affective Disorder	Seasonal Affective Disorder	PSYGENET_DG	11244145, 11735319, 12167522, 16899354, 20580209		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Severe major depression with psychotic features	Mental Depression With Psychotic Features	BEFREE	23221997		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Severe major depression with psychotic features	Mental Depression With Psychotic Features	PSYGENET_DG	23221997		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sexual Dysfunction	Sexual Dysfunction	BEFREE	22612784, 31792367		★☆☆☆☆ Found in Text Mining only
Shared Paranoid Disorder	Shared Paranoid Disorder	BEFREE	20211215		★☆☆☆☆ Found in Text Mining only
Skin carcinoma	Skin Carcinoma	BEFREE	21760883		★☆☆☆☆ Found in Text Mining only
Skin-picking	Skin-picking	HPO_DG			★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	20538960, 32367059	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	20538960, 21739010, 22074567, 22281949, 23988500, 24065538, 24475124, 24755731, 25917830		★☆☆☆☆ Found in Text Mining only
Status Migrainosus	Status Migrainosus	CTD_human_DG	12482207		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	26884719, 30446669		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	18761744		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	LHGDN	18761744		★☆☆☆☆ Found in Text Mining only
Temporomandibular Joint Disorders	Temporomandibular Joint Disorders	BEFREE	22074755		★☆☆☆☆ Found in Text Mining only
Testicular regression syndrome	Testicular regression syndrome	BEFREE	18359159		★☆☆☆☆ Found in Text Mining only
Thromboembolism	Thromboembolism	Pubtator	16179957	Associate	★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	10686553, 11121191, 11311507, 11317230, 11803534, 12422060, 14744462, 15469201, 17221840, 19428704, 19590397, 19897250, 19937159, 20047709, 21136126, 21838737, 22006095, 22612784, 23404241, 23547754, 24962835, 25108775, 25270656, 27756686, 28125323, 30221791, 31019472, 31721892		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	PSYGENET_DG	22612784, 24801750, 24962835, 25108775, 25270656		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	7623119	Associate	★☆☆☆☆ Found in Text Mining only