Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	3352
Gene name	5-hydroxytryptamine receptor 1D
Gene symbol	HTR1D
Synonyms (NCBI Gene)	5-HT1DHT1DAHTR1DAHTRLRDC4
Chromosome	1
Chromosome location	1p36.12

153

Show/Hide all (153)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019223	hsa-miR-335-5p	Microarray	18185580
MIRT042672	hsa-miR-196b-5p	CLASH	23622248
MIRT1057136	hsa-miR-128	CLIP-seq
MIRT1057137	hsa-miR-24	CLIP-seq
MIRT1057138	hsa-miR-2861	CLIP-seq
MIRT1057139	hsa-miR-31	CLIP-seq
MIRT1057140	hsa-miR-3122	CLIP-seq
MIRT1057141	hsa-miR-3133	CLIP-seq
MIRT1057142	hsa-miR-3148	CLIP-seq
MIRT1057143	hsa-miR-3187-3p	CLIP-seq
MIRT1057144	hsa-miR-3613-3p	CLIP-seq
MIRT1057145	hsa-miR-3616-3p	CLIP-seq
MIRT1057146	hsa-miR-3653	CLIP-seq
MIRT1057147	hsa-miR-3658	CLIP-seq
MIRT1057148	hsa-miR-371-5p	CLIP-seq
MIRT1057149	hsa-miR-371b-5p	CLIP-seq
MIRT1057150	hsa-miR-3913-5p	CLIP-seq
MIRT1057151	hsa-miR-4269	CLIP-seq
MIRT1057152	hsa-miR-4284	CLIP-seq
MIRT1057153	hsa-miR-4299	CLIP-seq
MIRT1057154	hsa-miR-4432	CLIP-seq
MIRT1057155	hsa-miR-4435	CLIP-seq
MIRT1057156	hsa-miR-450b-3p	CLIP-seq
MIRT1057157	hsa-miR-4645-5p	CLIP-seq
MIRT1057158	hsa-miR-4663	CLIP-seq
MIRT1057159	hsa-miR-4673	CLIP-seq
MIRT1057160	hsa-miR-4696	CLIP-seq
MIRT1057161	hsa-miR-4701-5p	CLIP-seq
MIRT1057162	hsa-miR-4728-3p	CLIP-seq
MIRT1057163	hsa-miR-4755-3p	CLIP-seq
MIRT1057164	hsa-miR-4781-3p	CLIP-seq
MIRT1057165	hsa-miR-548s	CLIP-seq
MIRT1057166	hsa-miR-570	CLIP-seq
MIRT1057167	hsa-miR-588	CLIP-seq
MIRT1057168	hsa-miR-642b	CLIP-seq
MIRT1057169	hsa-miR-769-3p	CLIP-seq
MIRT2013053	hsa-miR-1827	CLIP-seq
MIRT2013054	hsa-miR-2114	CLIP-seq
MIRT2013055	hsa-miR-3197	CLIP-seq
MIRT2013056	hsa-miR-335	CLIP-seq
MIRT2013057	hsa-miR-3612	CLIP-seq
MIRT2013058	hsa-miR-3664-5p	CLIP-seq
MIRT2013059	hsa-miR-3674	CLIP-seq
MIRT2013060	hsa-miR-3929	CLIP-seq
MIRT2013061	hsa-miR-4419b	CLIP-seq
MIRT2013062	hsa-miR-4443	CLIP-seq
MIRT2013063	hsa-miR-4478	CLIP-seq
MIRT2013064	hsa-miR-4649-3p	CLIP-seq
MIRT1057158	hsa-miR-4663	CLIP-seq
MIRT2013065	hsa-miR-4714-5p	CLIP-seq
MIRT2013066	hsa-miR-4767	CLIP-seq
MIRT2013067	hsa-miR-4786-5p	CLIP-seq
MIRT2013068	hsa-miR-485-5p	CLIP-seq
MIRT2013069	hsa-miR-516b	CLIP-seq
MIRT2013070	hsa-miR-650	CLIP-seq
MIRT1057136	hsa-miR-128	CLIP-seq
MIRT2245356	hsa-miR-1913	CLIP-seq
MIRT1057137	hsa-miR-24	CLIP-seq
MIRT1057140	hsa-miR-3122	CLIP-seq
MIRT1057143	hsa-miR-3187-3p	CLIP-seq
MIRT2245357	hsa-miR-324-3p	CLIP-seq
MIRT1057150	hsa-miR-3913-5p	CLIP-seq
MIRT1057151	hsa-miR-4269	CLIP-seq
MIRT1057152	hsa-miR-4284	CLIP-seq
MIRT2245358	hsa-miR-4313	CLIP-seq
MIRT1057155	hsa-miR-4435	CLIP-seq
MIRT1057156	hsa-miR-450b-3p	CLIP-seq
MIRT1057157	hsa-miR-4645-5p	CLIP-seq
MIRT1057159	hsa-miR-4673	CLIP-seq
MIRT1057161	hsa-miR-4701-5p	CLIP-seq
MIRT2245359	hsa-miR-4722-3p	CLIP-seq
MIRT1057163	hsa-miR-4755-3p	CLIP-seq
MIRT1057164	hsa-miR-4781-3p	CLIP-seq
MIRT1057165	hsa-miR-548s	CLIP-seq
MIRT1057167	hsa-miR-588	CLIP-seq
MIRT1057169	hsa-miR-769-3p	CLIP-seq
MIRT2013053	hsa-miR-1827	CLIP-seq
MIRT2013054	hsa-miR-2114	CLIP-seq
MIRT2013057	hsa-miR-3612	CLIP-seq
MIRT2013058	hsa-miR-3664-5p	CLIP-seq
MIRT2013059	hsa-miR-3674	CLIP-seq
MIRT2013060	hsa-miR-3929	CLIP-seq
MIRT2013061	hsa-miR-4419b	CLIP-seq
MIRT2013062	hsa-miR-4443	CLIP-seq
MIRT2013063	hsa-miR-4478	CLIP-seq
MIRT2013064	hsa-miR-4649-3p	CLIP-seq
MIRT2013065	hsa-miR-4714-5p	CLIP-seq
MIRT2013068	hsa-miR-485-5p	CLIP-seq
MIRT2013069	hsa-miR-516b	CLIP-seq
MIRT2013070	hsa-miR-650	CLIP-seq
MIRT2451465	hsa-miR-1227	CLIP-seq
MIRT2451466	hsa-miR-18a	CLIP-seq
MIRT2451467	hsa-miR-18b	CLIP-seq
MIRT2451468	hsa-miR-3064-3p	CLIP-seq
MIRT1057144	hsa-miR-3613-3p	CLIP-seq
MIRT1057148	hsa-miR-371-5p	CLIP-seq
MIRT1057149	hsa-miR-371b-5p	CLIP-seq
MIRT1057154	hsa-miR-4432	CLIP-seq
MIRT2451469	hsa-miR-4735-3p	CLIP-seq
MIRT2451470	hsa-miR-4761-5p	CLIP-seq
MIRT2451465	hsa-miR-1227	CLIP-seq
MIRT2451466	hsa-miR-18a	CLIP-seq
MIRT2451467	hsa-miR-18b	CLIP-seq
MIRT2451468	hsa-miR-3064-3p	CLIP-seq
MIRT1057139	hsa-miR-31	CLIP-seq
MIRT1057140	hsa-miR-3122	CLIP-seq
MIRT2013055	hsa-miR-3197	CLIP-seq
MIRT1057144	hsa-miR-3613-3p	CLIP-seq
MIRT1057145	hsa-miR-3616-3p	CLIP-seq
MIRT1057148	hsa-miR-371-5p	CLIP-seq
MIRT1057149	hsa-miR-371b-5p	CLIP-seq
MIRT1057150	hsa-miR-3913-5p	CLIP-seq
MIRT2548581	hsa-miR-4252	CLIP-seq
MIRT1057154	hsa-miR-4432	CLIP-seq
MIRT2548582	hsa-miR-4477a	CLIP-seq
MIRT1057156	hsa-miR-450b-3p	CLIP-seq
MIRT2013064	hsa-miR-4649-3p	CLIP-seq
MIRT1057158	hsa-miR-4663	CLIP-seq
MIRT1057160	hsa-miR-4696	CLIP-seq
MIRT1057162	hsa-miR-4728-3p	CLIP-seq
MIRT2451469	hsa-miR-4735-3p	CLIP-seq
MIRT2451470	hsa-miR-4761-5p	CLIP-seq
MIRT2013066	hsa-miR-4767	CLIP-seq
MIRT2548583	hsa-miR-508-5p	CLIP-seq
MIRT2548584	hsa-miR-548c-3p	CLIP-seq
MIRT2548585	hsa-miR-766	CLIP-seq
MIRT1057169	hsa-miR-769-3p	CLIP-seq
MIRT2451465	hsa-miR-1227	CLIP-seq
MIRT2451466	hsa-miR-18a	CLIP-seq
MIRT2451467	hsa-miR-18b	CLIP-seq
MIRT2451468	hsa-miR-3064-3p	CLIP-seq
MIRT1057139	hsa-miR-31	CLIP-seq
MIRT1057140	hsa-miR-3122	CLIP-seq
MIRT2013055	hsa-miR-3197	CLIP-seq
MIRT1057144	hsa-miR-3613-3p	CLIP-seq
MIRT1057145	hsa-miR-3616-3p	CLIP-seq
MIRT1057148	hsa-miR-371-5p	CLIP-seq
MIRT1057149	hsa-miR-371b-5p	CLIP-seq
MIRT1057150	hsa-miR-3913-5p	CLIP-seq
MIRT2548581	hsa-miR-4252	CLIP-seq
MIRT1057154	hsa-miR-4432	CLIP-seq
MIRT2548582	hsa-miR-4477a	CLIP-seq
MIRT1057156	hsa-miR-450b-3p	CLIP-seq
MIRT2013064	hsa-miR-4649-3p	CLIP-seq
MIRT1057158	hsa-miR-4663	CLIP-seq
MIRT1057160	hsa-miR-4696	CLIP-seq
MIRT1057162	hsa-miR-4728-3p	CLIP-seq
MIRT2451469	hsa-miR-4735-3p	CLIP-seq
MIRT2451470	hsa-miR-4761-5p	CLIP-seq
MIRT2548583	hsa-miR-508-5p	CLIP-seq
MIRT2548584	hsa-miR-548c-3p	CLIP-seq
MIRT2548585	hsa-miR-766	CLIP-seq
MIRT1057169	hsa-miR-769-3p	CLIP-seq

Show/Hide all (35)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001586	Function	Gi/o-coupled serotonin receptor activity	IDA	33762731
GO:0001586	Function	Gi/o-coupled serotonin receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004993	Function	G protein-coupled serotonin receptor activity	IBA
GO:0004993	Function	G protein-coupled serotonin receptor activity	IEA
GO:0004993	Function	G protein-coupled serotonin receptor activity	IMP	1652050
GO:0004993	Function	G protein-coupled serotonin receptor activity	TAS	1565658
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	1652050
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	1652050
GO:0006939	Process	Smooth muscle contraction	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007187	Process	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	IBA
GO:0007187	Process	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	TAS	1565658
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	ISS
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IMP	1652050
GO:0007198	Process	Adenylate cyclase-inhibiting serotonin receptor signaling pathway	IBA
GO:0007198	Process	Adenylate cyclase-inhibiting serotonin receptor signaling pathway	IDA	33762731
GO:0007198	Process	Adenylate cyclase-inhibiting serotonin receptor signaling pathway	IEA
GO:0007198	Process	Adenylate cyclase-inhibiting serotonin receptor signaling pathway	ISS
GO:0007268	Process	Chemical synaptic transmission	IBA
GO:0007268	Process	Chemical synaptic transmission	IEA
GO:0007268	Process	Chemical synaptic transmission	TAS	1565658
GO:0014827	Process	Intestine smooth muscle contraction	IMP	9186750
GO:0016020	Component	Membrane	IEA
GO:0030425	Component	Dendrite	IBA
GO:0030594	Function	Neurotransmitter receptor activity	IBA
GO:0040012	Process	Regulation of locomotion	IEA
GO:0042310	Process	Vasoconstriction	IEA
GO:0045202	Component	Synapse	IEA
GO:0050795	Process	Regulation of behavior	IEA
GO:0099589	Function	Serotonin receptor activity	IDA	33762731
GO:0099589	Function	Serotonin receptor activity	IEA

MIM	HGNC	e!Ensembl
182133	5289	ENSG00000179546

P28221

Protein name

5-hydroxytryptamine receptor 1D (5-HT-1D) (5-HT1D) (Serotonin 1D alpha receptor) (5-HT-1D-alpha) (Serotonin receptor 1D)

Protein function

G-protein coupled receptor for 5-hydroxytryptamine (serotonin) (PubMed:10452531, PubMed:1565658, PubMed:1652050, PubMed:33762731). Also functions as a receptor for ergot alkaloid derivatives, various anxiolytic and antidepressant drugs and other

PDB

7E32

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	55 → 356	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Detected in brain neocortex and caudate nucleus (at protein level). {ECO:0000269|PubMed:1828434}.

Sequence

MSPLNQSAEGLPQEASNRSLNATETSEAWDPRTLQALKISLAVVLSVITLATVLSNAFVL
TTILLTRKLHTPANYLIGSLATTDLLVSILVMPISIAYTITHTWNFGQILCDIWLSSDIT
CCTASILHLCVIALDRYWAITDALEYSKRRTAGHAATMIAIVWAISICISIPPLFWRQAK
AQEEMSDCLVNTSQISYTIYSTCGAFYIPSVLLIILYGRIYRAARNRILNPPSLYGKRFT
TAHLITGSAGSSLCSLNSSLHEGHSHSAGSPLFFNHVKIKLADSALERKRISAARERKAT
KILGIILGAFIICWLPFFVVSLVLPICRDSCWIHPALFDFFTWLGYLNSLINPIIYTVFN
EEFRQAFQKIVPFRKAS

Sequence length

377

Interactions

View interactions

	KEGG		Reactome
	cAMP signaling pathway Neuroactive ligand-receptor interaction Serotonergic synapse Taste transduction		Serotonin receptors G alpha (i) signalling events

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
AUTISTIC DISORDER	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM INFECTION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTENSION	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBSESSIVE-COMPULSIVE DISORDER	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TREATMENT-RESISTANT HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (29)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	34220331	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia	BEFREE	12740597, 16806108, 20946355, 21079607		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia	LHGDN	12740597		★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	17099886		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	17203304	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	CTD_human_DG	19038234		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	38482990	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Borderline Personality Disorder	Borderline personality disorder	BEFREE	19032968		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	39766808	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	8170966		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	38482990	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	26214021, 29183322, 31452735		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	PSYGENET_DG	21937687, 8018797		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	BEFREE	8018797		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Eating Disorders	Eating Disorders	BEFREE	12740597, 20946355		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	34493981	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	38482990	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	30561038		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	25170871		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	25170871		★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	27465216, 8170966, 8394988		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	8170966		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	22840963		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obsessive-Compulsive Disorder	Obsessive-Compulsive Disorder	CTD_human_DG	10621951		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	25170871		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	25170871, 25268648, 35813473	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	16059583, 8104876		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	33869632	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	35785570	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

HTR1D (5-hydroxytryptamine receptor 1D)