HTR1A (5-hydroxytryptamine receptor 1A)

Gene

• Entrez ID: 3350
• Gene name: 5-hydroxytryptamine receptor 1A
• Gene symbol: HTR1A
• Synonyms (NCBI Gene): 5-HT-1A, 5-HT1A, 5HT1a, ADRB2RL1, ADRBRL1, G-21, PFMCD
• Chromosome: 5
• Chromosome location: 5q12.3
• Summary: This gene encodes a G protein-coupled receptor for 5-hydroxytryptamine (serotonin), and belongs to the 5-hydroxytryptamine receptor subfamily. Serotonin has been implicated in a number of physiologic processes and pathologic conditions. Inactivation of th

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs6295	C>A,G	Likely-benign, benign, drug-response	Upstream transcript variant
rs367956927	T>-	Pathogenic	5 prime UTR variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018705	hsa-miR-335-5p	Microarray	18185580
MIRT438131	hsa-miR-135a-5p	Luciferase reporter assay	24952960
MIRT438131	hsa-miR-135a-5p	Luciferase reporter assay	24952960

Transcription factors

Transcription factor	Regulation	Reference
DEAF1	Repression	14507979
HES1	Unknown	18499474
HES6	Unknown	18499474
MAZ	Unknown	8626793
PARP1	Repression	21990073
SP1	Unknown	8626793

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001586	Function	Gi/o-coupled serotonin receptor activity	IDA	33762731, 37935376, 37935377
GO:0001586	Function	Gi/o-coupled serotonin receptor activity	IEA
GO:0001662	Process	Behavioral fear response	IEA
GO:0001662	Process	Behavioral fear response	ISS
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004993	Function	G protein-coupled serotonin receptor activity	IBA
GO:0004993	Function	G protein-coupled serotonin receptor activity	IDA	8393041
GO:0004993	Function	G protein-coupled serotonin receptor activity	IEA
GO:0004993	Function	G protein-coupled serotonin receptor activity	IMP	22957663
GO:0004993	Function	G protein-coupled serotonin receptor activity	TAS	9736659
GO:0005515	Function	Protein binding	IPI	22035699, 24157794, 25485703, 26365466
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	22957663
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	3138543
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IMP	22957663
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	1330092
GO:0007187	Process	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	IBA
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	ISS
GO:0007198	Process	Adenylate cyclase-inhibiting serotonin receptor signaling pathway	IBA
GO:0007198	Process	Adenylate cyclase-inhibiting serotonin receptor signaling pathway	IDA	8393041, 33762731, 35610220
GO:0007198	Process	Adenylate cyclase-inhibiting serotonin receptor signaling pathway	IEA
GO:0007198	Process	Adenylate cyclase-inhibiting serotonin receptor signaling pathway	ISS
GO:0007210	Process	Serotonin receptor signaling pathway	IEA
GO:0007210	Process	Serotonin receptor signaling pathway	ISS
GO:0007214	Process	Gamma-aminobutyric acid signaling pathway	IEA
GO:0007268	Process	Chemical synaptic transmission	IBA
GO:0008284	Process	Positive regulation of cell population proliferation	TAS	1330092
GO:0014062	Process	Regulation of serotonin secretion	IEA
GO:0014062	Process	Regulation of serotonin secretion	ISS
GO:0016020	Component	Membrane	IEA
GO:0019229	Process	Regulation of vasoconstriction	IEA
GO:0030425	Component	Dendrite	IBA
GO:0030425	Component	Dendrite	IEA
GO:0030594	Function	Neurotransmitter receptor activity	IBA
GO:0035640	Process	Exploration behavior	IEA
GO:0035640	Process	Exploration behavior	ISS
GO:0042053	Process	Regulation of dopamine metabolic process	IEA
GO:0042053	Process	Regulation of dopamine metabolic process	ISS
GO:0042428	Process	Serotonin metabolic process	IEA
GO:0042428	Process	Serotonin metabolic process	ISS
GO:0042995	Component	Cell projection	IEA
GO:0045202	Component	Synapse	IEA
GO:0046883	Process	Regulation of hormone secretion	IEA
GO:0050795	Process	Regulation of behavior	IEA
GO:0051378	Function	Serotonin binding	IBA
GO:0090722	Function	Receptor-receptor interaction	IDA	24157794
GO:0099589	Function	Serotonin receptor activity	IDA	33762731
GO:0099589	Function	Serotonin receptor activity	IEA

Other IDs

• MIM: 109760
• HGNC: 5286
• e!Ensembl: ENSG00000178394

Protein

• UniProt ID: P08908
• Protein name: 5-hydroxytryptamine receptor 1A (5-HT-1A) (5-HT1A) (G-21) (Serotonin receptor 1A)
• Protein function: G-protein coupled receptor for 5-hydroxytryptamine (serotonin) (PubMed:22957663, PubMed:3138543, PubMed:33762731, PubMed:37935376, PubMed:37935377, PubMed:8138923, PubMed:8393041). Also functions as a receptor for various drugs and psychoactive
• PDB: 7E2X, 7E2Y, 7E2Z, 8FY8, 8FYE, 8FYL, 8FYT, 8FYX, 8JSP, 8JT6, 8PJK, 8PKM, 8W8B
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	53 → 400	7 transmembrane receptor (rhodopsin family)	Family

• Tissue specificity: TISSUE SPECIFICITY: Detected in lymph nodes, thymus and spleen. Detected in activated T-cells, but not in resting T-cells. {ECO:0000269|PubMed:3041227, ECO:0000269|PubMed:8393041}.
• Sequence:

  MDVLSPGQGNNTTSPPAPFETGGNTTGISDVTVSYQVITSLLLGTLIFCAVLGNACVVAA
  IALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCC
  TSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPED
  RSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVKKVEKTGADT
  RHGASPAPQPKKSVNGESGSRNWRLGVESKAGGALCANGAVRQGDDGAALEVIEVHRVGN
  SKEHLPLPSEAGPTPCAPASFERKNERNAEAKRKMALARERKTVKTLGIIMGTFILCWLP
  FFIVALVLPFCESSCHMPTLLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIIKCKFC
  RQ

• Sequence length: 422

Pathways

KEGG:

cAMP signaling pathway
Neuroactive ligand-receptor interaction
Serotonergic synapse
Taste transduction

Reactome:

Serotonin receptors
G alpha (i) signalling events

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANHEDONIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANXIETY DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
APNEA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTROCYTOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRADYCARDIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRONCHOPULMONARY DYSPLASIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSION, BIPOLAR	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSION, POSTPARTUM	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EPILEPSY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GENERALISED EPILEPSY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HTR1A-related disorder	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTERSTITIAL LUNG DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEARNING DISABILITIES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEARNING DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSION, SINGLE EPISODE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MEMORY DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Menstrual cycle-dependent periodic fever	Uncertain significance; Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANIC DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHIATRIC DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHOSES, SUBSTANCE-INDUCED	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEIZURES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEVERE DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TREMOR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Abnormal involuntary movement	Abnormal Involuntary Movement	BEFREE	30612008		★☆☆☆☆ Found in Text Mining only
Adult Learning Disorders	Learning Disorders	CTD_human_DG	12591222		★☆☆☆☆ Found in Text Mining only
Age-Related Memory Disorders	Age-Related Memory Disorders	CTD_human_DG	12591222		★☆☆☆☆ Found in Text Mining only
Agoraphobia	Agoraphobia	BEFREE	14984628, 28096880		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	25041947	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anemia Sickle Cell	Sickle cell anemia	Pubtator	39615579	Associate	★☆☆☆☆ Found in Text Mining only
Angelman Syndrome	Angelman Syndrome	BEFREE	30681431		★☆☆☆☆ Found in Text Mining only
Anhedonia	Anhedonia	PSYGENET_DG	19896211		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anhedonia	Anhedonia	BEFREE	28119169		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anxiety	Anxiety disorder	Pubtator	10585418, 14984628, 19124686, 23408467, 29249830, 33874644	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	11374326, 11704418, 11742137, 14501251, 14666415, 14984628, 15683551, 18163385, 18639564, 19124686, 19423077, 19423080, 19894072, 20638825, 20643652, 22826341, 23907404, 24180393, 24337875, 25448266, 27157263, 29101244, 29363117, 30552180, 31045220, 31244623, 9826725		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	11704418, 11742137, 14501251, 14666415, 14984628, 15683551, 18047755, 18163385, 18639564, 19124686, 19423077, 19423080, 20638825, 20643652, 22222329, 22826341, 23907404, 24180393, 24337875, 25448266, 25514753, 27157263, 29101244, 29223391, 29254282, 29363117, 30552180, 30681431, 31045220, 31244623, 9826725		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anxiety Disorders	Anxiety disorder	Pubtator	18796187, 25514753, 37984468	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	26079129	Associate	★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	16887250, 20470849, 23308375, 26079129, 30074224		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	26782176		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	17203304	Associate	★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	26782176		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	22563461	Associate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	14744462, 20594600, 22752684, 24460115, 8333729		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	14744462, 20594600, 22752684, 24460115, 8546152		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	15458611, 19278673, 23434290, 23926239, 27063557	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Borderline Personality Disorder	Borderline personality disorder	BEFREE	14744462, 18387137		★☆☆☆☆ Found in Text Mining only
Borderline Personality Disorder	Borderline personality disorder	Pubtator	18387137	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	35199941	Associate	★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	14744462		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bulimia	Bulimia	BEFREE	12478878		★☆☆☆☆ Found in Text Mining only
Bulimia Nervosa	Bulimia	BEFREE	12478878		★☆☆☆☆ Found in Text Mining only
Bulimia Nervosa	Bulimia	Pubtator	20872754	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	17346815		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	29424302		★☆☆☆☆ Found in Text Mining only
Clonic Seizures	Clonic Seizures	CTD_human_DG	12646302, 16313900, 2533336		★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	29254282, 31544717		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	24158751		★☆☆☆☆ Found in Text Mining only
Complex partial seizures	Seizure	CTD_human_DG	12646302, 16313900, 2533336		★☆☆☆☆ Found in Text Mining only
Delirium	Delirium	BEFREE	26946964		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	LHGDN	18841018		★☆☆☆☆ Found in Text Mining only
Depression, Bipolar	Bipolar Disorder	BEFREE	19278673, 21397953		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depression, Bipolar	Bipolar Disorder	PSYGENET_DG	19278673, 21397953		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depression, Postpartum	Mental Depression	LHGDN	17543959		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depression, Postpartum	Mental Depression	PSYGENET_DG	20633050		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	BEFREE	10578452, 11704418, 11742136, 12020683, 12478878, 14666415, 14984628, 14998306, 15458611, 15534042, 15683551, 15885359, 16154547, 16467535, 17012696, 17401528, 17408646, 17570737, 18387740, 18639564, 18971477, 19105200, 19829169, 20025927, 20152112, 20515362, 20638825, 20643652, 21397953, 21449006, 21512427, 21577007, 22826341, 22868061, 23516322, 23809646, 24180393, 24274373, 24337875, 24462335, 25990886, 26001668, 26609890, 26721949, 28119169, 28196617, 28528967, 28920103, 29066953, 29101244, 29178685, 29424302, 29636529, 29865267, 30216226, 30301302, 30552180, 30664620, 31009821, 31120232, 31244623, 31418663, 31467884, 31541883, 31586041, 31781286, 31805950		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder	Major depressive disorder	Pubtator	10585418, 14984628, 15458611, 15758168, 16467535, 18796187, 18831910, 19278673, 23269215, 26926882, 28590587, 33874644, 35199941, 37958600, 37984468	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	PSYGENET_DG	23809646, 24180393, 24337875, 24462335, 25106036		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder Major	Major depressive disorder	Pubtator	14984628, 26926882	Associate	★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	27661418	Inhibit	★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	LHGDN	18181968		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	22563461	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	22563461		★☆☆☆☆ Found in Text Mining only
Disruptive Impulse Control and Conduct Disorders	Disruptive, impulse control, and conduct disorders	Pubtator	20872754, 23269215	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	20736508		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epilepsy, Temporal Lobe	Epilepsy	LHGDN	15111672		★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	22222329, 23333373, 23516322		★☆☆☆☆ Found in Text Mining only
Epileptic drop attack	Hypotonic seizures	CTD_human_DG	12646302, 16313900, 2533336		★☆☆☆☆ Found in Text Mining only
Generalized seizures	Seizure	CTD_human_DG	12646302, 16313900, 2533336		★☆☆☆☆ Found in Text Mining only
Generalized seizures	Seizure	BEFREE	29956631		★☆☆☆☆ Found in Text Mining only
Gilles de la Tourette syndrome	Tourette Syndrome	BEFREE	20010450, 7864272, 8546152, 8645269		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	30541912		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	8883928		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glycosuria Renal	Renal glycosuria	Pubtator	17009264	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG	21447133		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	12354289, 16887250		★☆☆☆☆ Found in Text Mining only
Hyperprolactinemia	Hyperprolactinemia	BEFREE	27654063		★☆☆☆☆ Found in Text Mining only
Hypopigmentation disorder	Hypopigmentation Disorder	BEFREE	24586946, 29430989		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	24158751, 29332488, 31601072		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	17714190		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	31515682		★☆☆☆☆ Found in Text Mining only
Jacksonian Seizure	Jacksonian Seizure	CTD_human_DG	12646302, 16313900, 2533336		★☆☆☆☆ Found in Text Mining only
Learning Disabilities	Learning Disorders	CTD_human_DG	12591222		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Learning Disorders	Learning Disorders	CTD_human_DG	12591222		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Learning Disturbance	Learning Disorders	CTD_human_DG	12591222		★☆☆☆☆ Found in Text Mining only
Lesch-Nyhan Syndrome	Lesch-Nyhan Syndrome	BEFREE	22403020		★☆☆☆☆ Found in Text Mining only
Leukodystrophy Metachromatic	Metachromatic leukodystrophy	Pubtator	18831910	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	26112163	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	17009264	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	17009264, 21382916		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	17009264		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	17009264	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	30862884		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	30862884	Associate	★☆☆☆☆ Found in Text Mining only
Major depression, single episode	Mental Depression	BEFREE	16154547, 16395308, 18387740, 19458612, 31120232		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major depression, single episode	Mental Depression	PSYGENET_DG	16154547, 16395308, 18387740, 19458612, 21577007		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	BEFREE	10578452, 14507979, 14984628, 15447813, 15534042, 15539859, 16154547, 16395308, 17284168, 17401528, 18268499, 18387740, 18484082, 18644006, 18706198, 18848359, 19105200, 19278673, 19358877, 19458612, 19590397, 19730445, 19900711, 20392296, 20453658, 20459391, 21512427, 21619616, 22727709, 22752684, 22826341, 23408467, 23440462, 23547754, 23809646, 24180393, 24607934, 24911443, 25578798, 25990886, 26780922, 26851834, 27756686, 28608854, 29275155, 29636529, 30093565, 30475091, 30807072, 31057436, 31114473, 31228794		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	LHGDN	16154547		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	PSYGENET_DG	23440462, 23809646, 24180393, 24607934, 24911443		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant Carcinoid Syndrome	Carcinoid tumor of intestine	BEFREE	28594246		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG	21447133		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	29424302		★☆☆☆☆ Found in Text Mining only
Melancholia	Melancholia	BEFREE	18387740		★☆☆☆☆ Found in Text Mining only
Memory Disorders	Memory Disorders	CTD_human_DG	12591222		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	BEFREE	10578452, 11704418, 11742136, 12020683, 12478878, 14666415, 14984628, 14998306, 15458611, 15534042, 15683551, 15885359, 16154547, 16467535, 17012696, 17401528, 17408646, 17570737, 18387740, 18639564, 18971477, 19105200, 19829169, 20025927, 20152112, 20515362, 20638825, 20643652, 21397953, 21449006, 21512427, 21577007, 22826341, 22868061, 23516322, 23809646, 24180393, 24274373, 24337875, 24462335, 25990886, 26001668, 26609890, 26721949, 28119169, 28196617, 28528967, 28920103, 29066953, 29101244, 29178685, 29424302, 29636529, 29865267, 30216226, 30301302, 30552180, 30664620, 31009821, 31120232, 31244623, 31418663, 31467884, 31541883, 31586041, 31805950		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	PSYGENET_DG	23809646, 24180393, 24337875, 24462335, 25106036		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental disorders	Mental Disorders	BEFREE	14744462, 15534042, 18047755, 18639564, 19997044, 20594600, 21619616, 22826341, 24337875, 24599137, 30694044		★☆☆☆☆ Found in Text Mining only
Mental Retardation	Mental retardation	BEFREE	17714190		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	16722981, 17417740, 23375453		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	HPO_DG			★☆☆☆☆ Found in Text Mining only
Miosis disorder	Miosis Disorder	BEFREE	27922541		★☆☆☆☆ Found in Text Mining only
Mixed anxiety and depressive disorder	Mixed Anxiety And Depressive Disorder	BEFREE	22826341		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	10578452, 10893489, 14744462, 15458611, 15469667, 15952185, 16467535, 16863269, 18047755, 18639564, 19381154, 19423080, 21182526, 22752684, 24607934, 25288485, 26001668, 26609890, 28970569, 29709878, 30664620, 7612160		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood Disorder	LHGDN	14744462, 15952185		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood disorder	Pubtator	15458611, 16467535, 23926239, 29709878, 35760877	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood Disorder	PSYGENET_DG	21419787, 22232550, 22752684, 24421401, 24607934		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasms	Neoplasms	BEFREE	29424302, 31009821		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	23192369, 31185062		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	22328058, 30347827		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	37958600	Associate	★☆☆☆☆ Found in Text Mining only
NEUROTICISM	Neuroticism	BEFREE	14666415, 18163385, 18796187		★☆☆☆☆ Found in Text Mining only
Obsessive-Compulsive Disorder	Obsessive-Compulsive Disorder	BEFREE	30232922		★☆☆☆☆ Found in Text Mining only
Ocular Hypertension	Ocular Hypertension	BEFREE	30541912		★☆☆☆☆ Found in Text Mining only
Panic Attacks	Panic Disorder	BEFREE	15469667, 19800133, 28073587, 28799955		★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic Disorder	BEFREE	12759158, 14984628, 15260943, 15534042, 15683551, 16316476, 16467535, 18663369, 18832011, 19423077, 19800133, 20817074, 21688171, 23635830, 26575296, 28096880, 28799955		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Panic Disorder	Panic Disorder	LHGDN	14736842, 16316476		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Panic Disorder	Panic disorder	Pubtator	15469667, 16316476, 16467535, 20817074, 29249830, 32723321	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Paranoid Schizophrenia	Paranoid Schizophrenia	BEFREE	23192369		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	17001660, 31765686		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	LHGDN	18841018		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	25514753	Associate	★☆☆☆☆ Found in Text Mining only
Personality Disorders	Personality Disorders	BEFREE	19894072		★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	23408467, 31105836, 31291234		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	16794822		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	18047755, 19747927		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	12478878, 14744462, 15205874, 15469667, 15683551, 17012696, 18308786, 1871320, 18839076, 18849890, 19352591, 19747927, 20533011, 20594600, 21194755, 21399903, 23036158, 24331356, 25822479, 26408209, 26568455, 27755061, 27756686, 27897266, 29128790, 29896132, 30695290, 30766477, 31601072, 8546152, 9734554, 9754630		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	LHGDN	14744462, 18606193, 18761712		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	15469667	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	24331356		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Seasonal Affective Disorder	Seasonal Affective Disorder	BEFREE	18663369		★☆☆☆☆ Found in Text Mining only
Severe depression	Mental Depression	PSYGENET_DG	22832728		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sexual Dysfunction	Sexual Dysfunction	BEFREE	25460030		★☆☆☆☆ Found in Text Mining only
Shared Paranoid Disorder	Shared Paranoid Disorder	BEFREE	19747927		★☆☆☆☆ Found in Text Mining only
Single Seizure	Seizure	CTD_human_DG	12646302, 16313900, 2533336		★☆☆☆☆ Found in Text Mining only
Smith-Lemli-Opitz Syndrome	Smith-Lemli-Opitz Syndrome	LHGDN	17493586		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG	21447133		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Tonic - clonic seizures	Seizure	CTD_human_DG	12646302, 16313900, 2533336		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	35199941	Inhibit	★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	10578452, 14507979, 14984628, 15447813, 15534042, 15539859, 17284168, 18268499, 18387740, 18484082, 18644006, 18848359, 19105200, 19278673, 19590397, 19900711, 20392296, 20453658, 20459391, 21512427, 21619616, 22727709, 22826341, 23408467, 23547754, 23809646, 24180393, 24911443, 26780922, 26851834, 27756686, 29636529, 30093565, 30807072, 31057436		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	PSYGENET_DG	23440462, 23809646, 24180393, 24607934, 24911443		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Visual seizure	Seizure	CTD_human_DG	12646302, 16313900, 2533336		★☆☆☆☆ Found in Text Mining only